ChEMBL logo

ChEMBL

spacer
ChEMBL Statistics
  Loading Statistics...
spacer

Compound Report Card

Compound Name and Classification

Compound ID CHEMBL1201668
CHEMBL1201668
Compound Name NESIRITIDE
ChEMBL Synonyms NATRECOR | NESIRITIDE | NESIRITIDE RECOMBINANT
Max Phase 4 (Approved)
Trade Names NATRECOR

Sources

  • Orange Book
  • USP Dictionary of USAN and International Drug Names
  • WHO Anatomical Therapeutic Chemical Classification

Molecule Features

CHEMBL1201668 compound icon
Drug Type:Oligopeptide Rule of Five:N First In Class:N Chirality:Single Stereoisomer Prodrug:N Oral:N Parenteral:Y Topical:N Black Box:N Availability Type:Prescription-only

Mechanism of Action

Mechanism of Action ChEMBL Target References
Atrial natriuretic peptide receptor A agonist Atrial natriuretic peptide receptor A DailyMed PubMed

Indications

MESH Heading MESH ID EFO ID EFO Term Max phase for indication References
HypertensionD006973EFO:0000537hypertension1ClinicalTrials
Myocardial InfarctionD009203EFO:0000612myocardial infarction2ClinicalTrials
Cardiovascular DiseasesD002318EFO:0000319cardiovascular disease4ATC
Heart FailureD006333EFO:0000373congestive heart failure3ClinicalTrials
MelanomaD008545EFO:0000756melanoma1ClinicalTrials
ObesityD009765EFO:0001073obesity0ClinicalTrials
Heart Defects, CongenitalD0063302ClinicalTrials
Diabetes MellitusD003920EFO:0000400diabetes mellitus1ClinicalTrials
Heart FailureD006333EFO:0003144heart failure3ClinicalTrials

Clinical Data

ClinicalTrials.gov NESIRITIDE
The Cochrane Collaboration NESIRITIDE

Biological Sequence

Description Sequence
Natriuretic peptides B MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVE QTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRI SSSSGLGCKVLRRH

Compound Cross References

ATC C - CARDIOVASCULAR SYSTEM
C01 - CARDIAC THERAPY
C01D - VASODILATORS USED IN CARDIAC DISEASES
C01DX - Other vasodilators used in cardiac diseases
C01DX19 - nesiritide

ChemSpider ChemSpider Identifier not yet assigned
DailyMed nesiritide recombinant
Wikipedia Nesiritide
spacer
spacer