ChEMBL logo

ChEMBL

spacer
ChEMBL Statistics
  Loading Statistics...
spacer

Compound Report Card

Compound Name and Classification

Compound ID CHEMBL1201613
CHEMBL1201613
Compound Name INSULIN GLULISINE
ChEMBL Synonyms APIDRA | INS APIDRA SOLOSTAR | INS APIDRA | INS APIDRA OPTICLIK | INS APIDRA OPTISET | HMR 1964 | INSULIN GLULISINE RECOMBINANT | INSULIN GLULISINE | APIDRA SOLOSTAR
Max Phase 4 (Approved)
Trade Names INS APIDRA OPTISET | INS APIDRA | INS APIDRA SOLOSTAR | APIDRA SOLOSTAR | INS APIDRA OPTICLIK | APIDRA

Sources

  • British National Formulary
  • Orange Book
  • USP Dictionary of USAN and International Drug Names
  • WHO Anatomical Therapeutic Chemical Classification

Molecule Features

CHEMBL1201613 compound icon
Drug Type:Oligopeptide Rule of Five:N First In Class:N Chirality:Single Stereoisomer Prodrug:N Oral:N Parenteral:Y Topical:N Black Box:N Availability Type:Prescription-only

Mechanism of Action

Mechanism of Action ChEMBL Target References
Insulin receptor agonist Insulin receptor DailyMed

Indications

MESH Heading MESH ID EFO ID EFO Term Max phase for indication References
Diabetes Mellitus, Type 2D003924EFO:0001360type II diabetes mellitus3ClinicalTrials
Diabetes MellitusD003920EFO:0000400diabetes mellitus4ATC
ClinicalTrials
Diabetes Mellitus, Type 1D003922EFO:0001359type I diabetes mellitus3ClinicalTrials
Down SyndromeD004314EFO:0001064Down syndrome1ClinicalTrials
Myocardial InfarctionD009203EFO:0000612myocardial infarction3ClinicalTrials
Alzheimer DiseaseD000544EFO:0000249Alzheimers disease2ClinicalTrials

Clinical Data

ClinicalTrials.gov INSULIN GLULISINE
The Cochrane Collaboration INSULIN GLULISINE

Biological Sequence

Description Sequence
Purified semisynthetic human insulin zinc suspension MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAED LQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN

Compound Cross References

ATC A - ALIMENTARY TRACT AND METABOLISM
A10 - DRUGS USED IN DIABETES
A10A - INSULINS AND ANALOGUES
A10AB - Insulins and analogues for injection, fast-acting
A10AB06 - insulin glulisine

ChemSpider ChemSpider Identifier not yet assigned
DailyMed insulin glulisine recombinant
spacer
spacer