ChEMBL logo

ChEMBL

spacer
ChEMBL Statistics
  Loading Statistics...
spacer

Compound Report Card

Compound Name and Classification

Compound ID CHEMBL1201610
CHEMBL1201610
Compound Name CORTICOTROPIN
ChEMBL Synonyms CORTICOTROPIN | ACTHAR | CORTICOTROPIN, REPOSITORY | Adrenomone | ACTH | CORTROPHIN | H.P. ACTHAR GEL | ACTHAR GEL | REPOSITORY CORTICOTROPIN | CORTIGEL | Adrenocorticotropin | PURIFIED CORTROPHIN GEL | Adrenocorticotropic Hormone
Max Phase 4 (Approved)
Trade Names ACTHAR GEL | Adrenocorticotropin | CORTIGEL | H.P. ACTHAR GEL | PURIFIED CORTROPHIN GEL | ACTH | CORTROPHIN | Adrenocorticotropic Hormone | ACTHAR | CORTICOTROPIN | Adrenomone

Sources

  • British National Formulary
  • Manually Added Drugs
  • Orange Book
  • USP Dictionary of USAN and International Drug Names
  • WHO Anatomical Therapeutic Chemical Classification

Molecule Features

CHEMBL1201610 compound icon
Drug Type:Oligopeptide Rule of Five:N First In Class:N Chirality:Single Stereoisomer Prodrug:N Oral:N Parenteral:Y Topical:N Black Box:N Availability Type:Prescription-only

Mechanism of Action

Mechanism of Action ChEMBL Target References
Melanocortin receptor 2 agonist Melanocortin receptor 2 FDA IUPHAR

Indications

MESH Heading MESH ID EFO ID EFO Term Max phase for indication References
NeuroblastomaD009447EFO:0000621neuroblastoma3ClinicalTrials
ClinicalTrials
Polyradiculoneuropathy, Chronic Inflammatory DemyelinatingD020277EFO:1000868chronic inflammatory demyelinating polyradiculoneuropathy2ClinicalTrials
ClinicalTrials
Glomerulonephritis, MembranousD015433EFO:0004254membranous glomerulonephritis1ClinicalTrials
ClinicalTrials
Migraine DisordersD008881EFO:0003821migraine disorder2ClinicalTrials
ClinicalTrials
Multiple SclerosisD009103EFO:0003885multiple sclerosis3ClinicalTrials
ClinicalTrials
Multiple Sclerosis, Chronic ProgressiveD020528EFO:0003840chronic progressive multiple sclerosis2ClinicalTrials
ClinicalTrials
Nephrotic SyndromeD009404EFO:0004255nephrotic syndrome3ClinicalTrials
ClinicalTrials
PolymyositisD017285EFO:0003063polymyositis2ClinicalTrials
ClinicalTrials
Multiple Sclerosis, Relapsing-RemittingD020529EFO:0003929relapsing-remitting multiple sclerosis3ClinicalTrials
ClinicalTrials
Amyotrophic Lateral SclerosisD000690EFO:0000253amyotrophic lateral sclerosis2ClinicalTrials
ClinicalTrials
Renal Insufficiency, ChronicD051436EFO:0003884chronic kidney disease1ClinicalTrials
ClinicalTrials
Optic NeuritisD009902EFO:0007405optic neuritis0ClinicalTrials
ClinicalTrials
Arthritis, RheumatoidD001172EFO:0000685rheumatoid arthritis2ClinicalTrials
ClinicalTrials
DermatomyositisD003882EFO:0000398dermatomyositis2ClinicalTrials
ClinicalTrials
Respiratory Distress Syndrome, AdultD012128EFO:1000637acute respiratory distress syndrome2ClinicalTrials
ClinicalTrials
SarcoidosisD012507Orphanet:797Sarcoidosis2ClinicalTrials
ClinicalTrials
UveitisD014605EFO:1001231uveitis2ClinicalTrials
ClinicalTrials
Diabetic NephropathiesD003928EFO:0000401diabetic nephropathy2ClinicalTrials
ClinicalTrials
EpilepsyD004827EFO:0000474epilepsy2ClinicalTrials
ClinicalTrials

Clinical Data

ClinicalTrials.gov CORTICOTROPIN
The Cochrane Collaboration CORTICOTROPIN

Biological Sequence

Description Sequence
Corticotropin-lipotropin precursor MPRSCCSRSGALLLALLLQASMEVRGWCLESSQCQDLTTESNLLECIRACKPDLSAETPM FPGNGDEQPLTENPRKYVMGHFRWDRFGRRNSSSSGSSGAGQKREDVSAGEDCGPLPEGG PEPRSDGAKPGPREGKRSYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEFKREL TGQRLREGDGPDGPADDGAGAQADLEHSLLVAAEKKDEGPYRMEHFRWGSPPKDKRYGGF MTSEKSQTPLVTLFKNAIIKNAYKKGE

Compound Cross References

ATC H - SYSTEMIC HORMONAL PREPARATIONS, EXCL. SEX HORMONES AND INSULINS
H01 - PITUITARY AND HYPOTHALAMIC HORMONES AND ANALOGUES
H01A - ANTERIOR PITUITARY LOBE HORMONES AND ANALOGUES
H01AA - ACTH
H01AA01 - corticotropin

ChemSpider ChemSpider Identifier not yet assigned
DailyMed corticotropin
spacer
spacer