ChEMBL logo

ChEMBL

spacer
ChEMBL Statistics
  Loading Statistics...
spacer

Compound Report Card

Compound Name and Classification

Compound ID CHEMBL1201605
CHEMBL1201605
Compound Name DACLIZUMAB
ChEMBL Synonyms RO-24-7375 | ZENAPAX | ZINBRYTA | DACLIZUMAB
Max Phase 4 (Approved)
Trade Names ZENAPAX | ZINBRYTA

Sources

  • British National Formulary
  • Clinical Candidates
  • Manually Added Drugs
  • USP Dictionary of USAN and International Drug Names
  • WHO Anatomical Therapeutic Chemical Classification

Molecule Features

CHEMBL1201605 compound icon
Drug Type:Antibody Rule of Five:N First In Class:N Chirality:Single Stereoisomer Prodrug:N Oral:N Parenteral:Y Topical:N Black Box:N Availability Type:Prescription-only

Mechanism of Action

Mechanism of Action ChEMBL Target References
Interleukin-2 receptor inhibitor Interleukin-2 receptor DailyMed FDA

Indications

MESH Heading MESH ID EFO ID EFO Term Max phase for indication References
AsthmaD001249EFO:0000270asthma2ClinicalTrials
Colitis, UlcerativeD003093EFO:0000729ulcerative colitis2ClinicalTrials
Diabetes MellitusD003920EFO:0000400diabetes mellitus2ClinicalTrials
Multiple SclerosisD009103EFO:0003885multiple sclerosis3ClinicalTrials
Multiple Sclerosis, Relapsing-RemittingD020529EFO:0003929relapsing-remitting multiple sclerosis4ClinicalTrials
FDA
DiGeorge SyndromeD004062Orphanet:56722q11.2 deletion syndrome1ClinicalTrials
LeukemiaD007938EFO:0000565leukemia2ClinicalTrials
LymphomaD008223EFO:0000574lymphoma2ClinicalTrials
MelanomaD008545EFO:0000756melanoma1ClinicalTrials
Multiple MyelomaD009101EFO:0001378multiple myeloma2ClinicalTrials
Graft vs Host DiseaseD006086EFO:0004599acute graft vs. host disease3ClinicalTrials
Hodgkin DiseaseD006689EFO:0000183Hodgkins lymphoma1ClinicalTrials
UveitisD014605EFO:1001231uveitis2ClinicalTrials
Diabetes Mellitus, Type 1D003922EFO:0001359type I diabetes mellitus3ClinicalTrials
Granulomatosis with PolyangiitisD014890EFO:0005297Wegener's granulomatosis2ClinicalTrials
Immune System DiseasesD007154EFO:0000540immune system disease4ATC
Myelodysplastic SyndromesD009190EFO:0000198myelodysplastic syndrome2ClinicalTrials
PsoriasisD011565EFO:0000676psoriasis1ClinicalTrials
Uveitis, PosteriorD015866EFO:1001119posterior uveitis2ClinicalTrials
HIV InfectionsD015658EFO:0000764HIV infection1ClinicalTrials
Kidney DiseasesD007674EFO:0003086kidney disease1ClinicalTrials
NeoplasmsD009369EFO:0000616neoplasm1ClinicalTrials
ThrombocytopeniaD013921HP:0001873thrombocytopenia2ClinicalTrials

Clinical Data

ClinicalTrials.gov DACLIZUMAB
The Cochrane Collaboration DACLIZUMAB

Biological Sequence

Description Sequence
Daclizumab heavy chain QVQLVQSGAEVKKPGSSVKVSCKASGYTFTSYRMHWVRQAPGQGLEWIGYINPSTGYTEY NQKFKDKATITADESTNTAYMELSSLRSEDTAVYYCARGGGVFDYWGQGTTLTVSSGPSV FPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSV VTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSCDKTHTCPPCPAPELLGGPSVFLFPP KPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSV LTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSL TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSC SVMHEALHNHYTQKSLSLSPGK
Daclizumab light chain DIQMTQSPSTLSASVGDRVTITCSASSSISYMHWYQQKPGKAPKLLIYTTSNLASGVPAR FSGSGSGTEFTLTISSLQPDDFATYYCHQRSTYPLTFGSGTKVEVKRTVAAPSVFIFPPS DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL SKADYEKHKVYACEVTHQGLSSPVTKSFNR

Compound Cross References

ATC L - ANTINEOPLASTIC AND IMMUNOMODULATING AGENTS
L04 - IMMUNOSUPPRESSANTS
L04A - IMMUNOSUPPRESSANTS
L04AC - Interleukin inhibitors
L04AC01 - daclizumab

ChemSpider ChemSpider Identifier not yet assigned
DailyMed daclizumab
Wikipedia Daclizumab
spacer
spacer