ChEMBL logo

ChEMBL

spacer
ChEMBL Statistics
  Loading Statistics...
spacer

Compound Report Card

Compound Name and Classification

Compound ID CHEMBL1201589
CHEMBL1201589
Compound Name OMALIZUMAB
ChEMBL Synonyms OMALIZUMAB | XOLAIR | IGE25 | OLIZUMAB | RHUMAB-E25 | RG-3648
Max Phase 4 (Approved)
Trade Names XOLAIR

Sources

  • British National Formulary
  • Clinical Candidates
  • Manually Added Drugs
  • USP Dictionary of USAN and International Drug Names
  • WHO Anatomical Therapeutic Chemical Classification

Molecule Features

CHEMBL1201589 compound icon
Drug Type:Antibody Rule of Five:N First In Class:N Chirality:Single Stereoisomer Prodrug:N Oral:N Parenteral:Y Topical:N Black Box:Y Availability Type:Prescription-only

Mechanism of Action

Mechanism of Action ChEMBL Target References
Ig epsilon chain C region inhibitor Ig epsilon chain C region DailyMed PubMed

Indications

MESH Heading MESH ID EFO ID EFO Term Max phase for indication References
AsthmaD001249EFO:0000270asthma4ClinicalTrials
DailyMed
Colonic NeoplasmsD003110EFO:1001950colon carcinoma1ClinicalTrials
Dermatitis, AtopicD003876EFO:0000274atopic eczema2ClinicalTrials
Pulmonary Disease, Chronic ObstructiveD029424EFO:0000341chronic obstructive pulmonary disease2ClinicalTrials
GastroenteritisD005759EFO:1001463gastroenteritis2ClinicalTrials
Job SyndromeD007589EFO:0003775Job's syndrome1ClinicalTrials
Lupus Erythematosus, SystemicD008180EFO:0002690systemic lupus erythematosus1ClinicalTrials
UrticariaD014581EFO:0005531urticaria4ClinicalTrials
DailyMed
Food HypersensitivityD005512EFO:1001890food allergy2ClinicalTrials
Immune System DiseasesD007154EFO:0000540immune system disease2ClinicalTrials
Lung Diseases, ObstructiveD008173HP:0006536obstructive lung disease4ATC
Milk HypersensitivityD016269EFO:0007369milk allergic reaction2ClinicalTrials
HypersensitivityD006967EFO:0003785allergy2ClinicalTrials
Pemphigoid, BullousD010391EFO:0007187bullous pemphigoid2ClinicalTrials
SinusitisD012852EFO:0007486sinusitis2ClinicalTrials
Peanut HypersensitivityD021183EFO:0007425peanut allergic reaction2ClinicalTrials
Rhinitis, Allergic, SeasonalD006255EFO:0003956seasonal allergic rhinitis3ClinicalTrials
Eosinophilic EsophagitisD057765EFO:0004232eosinophilic esophagitis2ClinicalTrials

Clinical Data

ClinicalTrials.gov OMALIZUMAB
The Cochrane Collaboration OMALIZUMAB

Biological Sequence

Description Sequence
Omalizumab heavy chain EVQLVESGGGLVQPGGSLRLSCAVSGYSITSGYSWNWIRQAPGKGLEWVASITYDGSTNY ADSVKGRFTISRDDSKNTFYLQMNSLRAEDTAVYYCARGSHYFGHWHFAVWGQGTLVTVS SGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY SLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSCDKTHTCPPCPAPELLGGPSV FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTY RVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTK NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG NVFSCSVMHEALHNHYTQKSLSLSPGK
Omalizumab light chain DIQLTQSPSSLSASVGDRVTITCRASQSVDYDGDSYMNWYQQKPGKAPKLLIYAASYLES GVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSHEDPYTFGQGTKVEIKRTVAAPSVF IFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLS STLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNR

Compound Cross References

ATC R - RESPIRATORY SYSTEM
R03 - DRUGS FOR OBSTRUCTIVE AIRWAY DISEASES
R03D - OTHER SYSTEMIC DRUGS FOR OBSTRUCTIVE AIRWAY DISEASES
R03DX - Other systemic drugs for obstructive airway diseases
R03DX05 - omalizumab

ChemSpider ChemSpider Identifier not yet assigned
DailyMed omalizumab
Wikipedia Omalizumab
spacer
spacer