ChEMBL logo

ChEMBL

spacer
ChEMBL Statistics
  Loading Statistics...
spacer

Compound Report Card

Compound Name and Classification

Compound ID CHEMBL1201587
CHEMBL1201587
Compound Name ALEMTUZUMAB
ChEMBL Synonyms MABCAMPATH | CAMPATH MABCAMPATH | CAMPATH-1H | ALEMTUZUMAB | CAMPATH | LDP-03 | Campath MabCampath, Lemtrada | LEMTRADA
Max Phase 4 (Approved)
Trade Names Campath MabCampath, Lemtrada | LEMTRADA | CAMPATH | CAMPATH MABCAMPATH | MABCAMPATH

Sources

  • British National Formulary
  • Clinical Candidates
  • Manually Added Drugs
  • USP Dictionary of USAN and International Drug Names
  • WHO Anatomical Therapeutic Chemical Classification

Molecule Features

CHEMBL1201587 compound icon
Drug Type:Antibody Rule of Five:N First In Class:N Chirality:Single Stereoisomer Prodrug:N Oral:N Parenteral:Y Topical:N Black Box:Y Availability Type:Prescription-only

Mechanism of Action

Mechanism of Action ChEMBL Target References
CAMPATH-1 antigen inhibitor CAMPATH-1 antigen DailyMed

Indications

MESH Heading MESH ID EFO ID EFO Term Max phase for indication References
Fanconi AnemiaD005199Orphanet:84Fanconi anemia1ClinicalTrials
Graft vs Host DiseaseD006086EFO:0004599acute graft vs. host disease2ClinicalTrials
Hematologic NeoplasmsD019337EFO:0001642lymphoid neoplasm2ClinicalTrials
Immune System DiseasesD007154EFO:0000540immune system disease4ATC
ClinicalTrials
LymphomaD008223EFO:0000574lymphoma3ClinicalTrials
Multiple Sclerosis, Relapsing-RemittingD020529EFO:0003929relapsing-remitting multiple sclerosis3ClinicalTrials
Myelodysplastic SyndromesD009190EFO:0000198myelodysplastic syndrome3ClinicalTrials
NeoplasmsD009369EFO:0000616neoplasm2ClinicalTrials
OsteopetrosisD010022Orphanet:2781Osteopetrosis2ClinicalTrials
beta-ThalassemiaD017086Orphanet:848Beta-thalassemia2ClinicalTrials
AnemiaD000740EFO:0004272anemia1ClinicalTrials
Anemia, Sickle CellD000755Orphanet:232Sickle cell anemia3ClinicalTrials
HistiocytosisD015614HP:0100727Histiocytosis2ClinicalTrials
LeukemiaD007938EFO:0000565leukemia3ClinicalTrials
Leukemia, Biphenotypic, AcuteD015456EFO:0000209T-cell acute lymphoblastic leukemia2ClinicalTrials
Leukemia, Erythroblastic, AcuteD004915EFO:1001257acute erythroblastic leukemia2ClinicalTrials
Leukemia, LymphoidD007945EFO:0004289lymphoid leukemia2ClinicalTrials
Kidney DiseasesD007674EFO:0003086kidney disease1ClinicalTrials
Liver DiseasesD008107EFO:0001421liver disease2ClinicalTrials
Lymphoma, Large B-Cell, DiffuseD016403EFO:0000403diffuse large B-cell lymphoma2ClinicalTrials
Lymphoma, Non-HodgkinD008228EFO:0005952non-Hodgkins lymphoma1ClinicalTrials
Metabolic DiseasesD008659EFO:0000589metabolic disease1ClinicalTrials
Myositis, Inclusion BodyD018979EFO:0007323inclusion body myositis2ClinicalTrials
Crohn DiseaseD003424EFO:0000384Crohn's disease1ClinicalTrials
Hodgkin DiseaseD006689EFO:0000183Hodgkins lymphoma2ClinicalTrials
Lymphohistiocytosis, HemophagocyticD051359Orphanet:158038Primary hemophagocytic lymphohistiocytosis1ClinicalTrials
Lymphoma, T-Cell, PeripheralD016411EFO:0000211unspecified peripheral T-cell lymphoma3ClinicalTrials
Anemia, AplasticD000741EFO:0006927severe aplastic anemia2ClinicalTrials
Carcinoma, Renal CellD002292EFO:0002890renal carcinoma2ClinicalTrials
Leukemia, Lymphocytic, Chronic, B-CellD015451EFO:0000095chronic lymphocytic leukemia4ClinicalTrials
DailyMed
Multiple MyelomaD009101EFO:0001378multiple myeloma1ClinicalTrials
Precursor Cell Lymphoblastic Leukemia-LymphomaD054198EFO:0000220acute lymphoblastic leukemia2ClinicalTrials
ThalassemiaD013789EFO:1001996Thalassemia2ClinicalTrials
Anemia, AplasticD000741HP:0001915aplastic anemia2ClinicalTrials
Immunoblastic LymphadenopathyD007119EFO:0000255angioimmunoblastic T-cell lymphoma3ClinicalTrials
Waldenstrom MacroglobulinemiaD008258EFO:0002616macroglobulinemia2ClinicalTrials
Lymphoproliferative DisordersD0082322ClinicalTrials
Multiple SclerosisD009103EFO:0003885multiple sclerosis4ClinicalTrials
DailyMed
NeuroblastomaD009447EFO:0000621neuroblastoma1ClinicalTrials
Diabetes Mellitus, Type 1D003922EFO:0001359type I diabetes mellitus2ClinicalTrials
Granulomatous Disease, ChronicD006105Orphanet:379Chronic granulomatous disease2ClinicalTrials
Leukemia, Myeloid, AcuteD015470EFO:0000222acute myeloid leukemia3ClinicalTrials
Mycosis FungoidesD009182EFO:1001051mycosis fungoides2ClinicalTrials
NeoplasmsD009369EFO:0000311cancer2ClinicalTrials
Severe Combined ImmunodeficiencyD016511Orphanet:183660Severe combined immunodeficiency2ClinicalTrials
Sezary SyndromeD012751EFO:1000785Sezary's disease2ClinicalTrials

Clinical Data

ClinicalTrials.gov ALEMTUZUMAB
The Cochrane Collaboration ALEMTUZUMAB

Biological Sequence

Description Sequence
Alemtuzumab heavy chain QVQLQESGPGLVRPSQTLSLTCTVSGFTFTDFYMNWVRQPPGRGLEWIGFIRDKAKGYTT EYNPSVKGRVTMLVDTSKNQFSLRLSSVTAADTAVYYCAREGHTAAPFDYWGQGSLVTVS SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLG GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Alemtuzumab light chain DIQMTQSPSSLSASVGDRVTITCKASQNIDKYLNWYQQKPGKAPKLLIYNTNNLQTGVPS RFSGSGSGTDFTFTISSLQPEDIATYYCLQHISRPRTFGQGTKVEIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNR

Compound Cross References

ATC L - ANTINEOPLASTIC AND IMMUNOMODULATING AGENTS
L04 - IMMUNOSUPPRESSANTS
L04A - IMMUNOSUPPRESSANTS
L04AA - Selective immunosuppressants
L04AA34 - alemtuzumab

ChemSpider ChemSpider Identifier not yet assigned
DailyMed alemtuzumab
Wikipedia Alemtuzumab
spacer
spacer