ChEMBL logo

ChEMBL

spacer
ChEMBL Statistics
  Loading Statistics...
spacer

Compound Report Card

Compound Name and Classification

Compound ID CHEMBL1201583
CHEMBL1201583
Compound Name BEVACIZUMAB
ChEMBL Synonyms RHUMAB-VEGF | R-435 | 12-IGG1 | RG-435 | BEVACIZUMAB | AVASTIN
Max Phase 4 (Approved)
Trade Names AVASTIN

Sources

  • British National Formulary
  • Clinical Candidates
  • Manually Added Drugs
  • USP Dictionary of USAN and International Drug Names
  • WHO Anatomical Therapeutic Chemical Classification

Molecule Features

CHEMBL1201583 compound icon
Drug Type:Antibody Rule of Five:N First In Class:N Chirality:Single Stereoisomer Prodrug:N Oral:N Parenteral:Y Topical:N Black Box:Y Availability Type:Prescription-only

Mechanism of Action

Mechanism of Action ChEMBL Target References
Vascular endothelial growth factor A inhibitor Vascular endothelial growth factor A DailyMed PubMed

Indications

MESH Heading MESH ID EFO ID EFO Term Max phase for indication References
AstrocytomaD001254EFO:0002499anaplastic astrocytoma2ClinicalTrials
Brain NeoplasmsD001932EFO:0003833brain neoplasm2ClinicalTrials
Breast NeoplasmsD001943EFO:0000305breast carcinoma3ClinicalTrials
Carcinoid TumorD002276EFO:0004243carcinoid tumor2ClinicalTrials
Carcinoma, HepatocellularD006528EFO:0000182hepatocellular carcinoma3ClinicalTrials
Carcinoma, Large CellD018287EFO:0003050large cell lung carcinoma2ClinicalTrials
Carcinoma, Renal CellD002292EFO:0000335chromophobe renal cell carcinoma4ClinicalTrials
Head and Neck NeoplasmsD006258EFO:0006859head and neck malignant neoplasia2ClinicalTrials
HemangiosarcomaD006394EFO:0003968angiosarcoma2ClinicalTrials
KeloidD007627EFO:0004212Keloid2ClinicalTrials
Leukemia, LymphoidD007945EFO:0004289lymphoid leukemia2ClinicalTrials
LymphomaD008223EFO:0000574lymphoma2ClinicalTrials
Lymphoma, Mantle-CellD020522EFO:1001469Mantle cell lymphoma2ClinicalTrials
MelanomaD008545EFO:0000756melanoma2ClinicalTrials
Myelodysplastic SyndromesD009190EFO:0000198myelodysplastic syndrome2ClinicalTrials
NeuroblastomaD009447EFO:0000621neuroblastoma2ClinicalTrials
OligodendrogliomaD009837EFO:0000632oligodendroglioma2ClinicalTrials
Ovarian NeoplasmsD010051Orphanet:398934Malignant epithelial tumor of ovary3ClinicalTrials
Retinal DiseasesD012164EFO:0003839retinopathy3ClinicalTrials
UveitisD014605EFO:1001231uveitis3ClinicalTrials
AdenocarcinomaD000230EFO:0000228adenocarcinoma3ClinicalTrials
Breast NeoplasmsD001943EFO:0003869breast neoplasm3ClinicalTrials
Carcinoma, Renal CellD002292EFO:0000640papillary renal cell carcinoma4ClinicalTrials
Carcinoma, Squamous CellD002294EFO:0000181head and neck squamous cell carcinoma2ClinicalTrials
CholangiocarcinomaD018281EFO:0005221cholangiocarcinoma2ClinicalTrials
Colorectal NeoplasmsD015179EFO:0000365colorectal adenocarcinoma4ClinicalTrials
DailyMed
Colorectal NeoplasmsD015179EFO:0004142colorectal neoplasm4ClinicalTrials
Diabetic NeuropathiesD003929EFO:1000783diabetic neuropathy1ClinicalTrials
GliosarcomaD018316EFO:1001465gliosarcoma3ClinicalTrials
HistiocytomaD051642EFO:0005561histiocytoma2ClinicalTrials
LeukemiaD007938EFO:0000565leukemia2ClinicalTrials
Lymphoma, Non-HodgkinD008228EFO:0005952non-Hodgkins lymphoma2ClinicalTrials
Macular EdemaD0082693ClinicalTrials
ClinicalTrials
MedulloblastomaD008527EFO:0002939medulloblastoma2ClinicalTrials
Multiple MyelomaD009101EFO:0001378multiple myeloma2ClinicalTrials
NeoplasmsD009369EFO:0000311cancer4ClinicalTrials
Neoplasms, Germ Cell and EmbryonalD009373EFO:0000514germ cell tumor2ClinicalTrials
Neuroectodermal Tumors, PrimitiveD018242EFO:0005235primitive neuroectodermal tumor2ClinicalTrials
Optic Neuropathy, IschemicD018917EFO:1000809anterior ischemic optic neuropathy2ClinicalTrials
Ovarian NeoplasmsD010051EFO:0003893ovarian neoplasm3ClinicalTrials
Rectal NeoplasmsD012004EFO:1000657rectum cancer3ClinicalTrials
Vascular DiseasesD014652EFO:0004264vascular disease2ClinicalTrials
Endometrial NeoplasmsD016889EFO:0004230endometrial neoplasm2ClinicalTrials
Endometrial NeoplasmsD016889EFO:1001512endometrial carcinoma2ClinicalTrials
FibrosarcomaD005354EFO:0002087fibrosarcoma2ClinicalTrials
GlaucomaD005901EFO:0000516glaucoma3ClinicalTrials
Leukemia, Lymphocytic, Chronic, B-CellD015451EFO:0000095chronic lymphocytic leukemia2ClinicalTrials
MelanomaD008545EFO:0000389cutaneous melanoma2ClinicalTrials
MelanomaD008545EFO:0002617metastatic melanoma2ClinicalTrials
OligodendrogliomaD009837EFO:0002501anaplastic oligodendroglioma2ClinicalTrials
Ovarian NeoplasmsD010051EFO:0001075ovarian carcinoma3ClinicalTrials
Renal Insufficiency, ChronicD051436EFO:0003884chronic kidney disease0ClinicalTrials
Retinal DetachmentD012163EFO:0005773retinal detachment3ClinicalTrials
SarcomaD012509EFO:0000691sarcoma2ClinicalTrials
SarcomaD012509EFO:1001968soft tissue sarcoma2ClinicalTrials
Sarcoma, EwingD012512EFO:0000174Ewing sarcoma2ClinicalTrials
Small Cell Lung CarcinomaD055752EFO:0000702small cell lung carcinoma2ClinicalTrials
Breast Neoplasms, MaleD018567EFO:0006861male breast carcinoma3ClinicalTrials
Carcinoma, Merkel CellD015266EFO:1001471Merkel cell skin cancer1ClinicalTrials
Carcinoma, Squamous CellD002294EFO:0000707squamous cell carcinoma2ClinicalTrials
EndometriosisD004715EFO:0001065endometriosis1ClinicalTrials
Gastrointestinal Stromal TumorsD046152Orphanet:44890Gastrointestinal stromal tumor3ClinicalTrials
GliomaD005910EFO:0000326central nervous system cancer2ClinicalTrials
Leukemia, Myelogenous, Chronic, BCR-ABL PositiveD015464EFO:0000339chronic myelogenous leukemia2ClinicalTrials
Pleural EffusionD0109963ClinicalTrials
Sex Cord-Gonadal Stromal TumorsD018312EFO:0007483sex cord-gonadal stromal tumor2ClinicalTrials
Thyroid NeoplasmsD013964EFO:0002892thyroid carcinoma2ClinicalTrials
Uveomeningoencephalitic SyndromeD014607Orphanet:3437Vogt-Koyanagi-Harada disease3ClinicalTrials
AstrocytomaD001254EFO:0000272astrocytoma2ClinicalTrials
CarcinomaD002277EFO:0000313carcinoma2ClinicalTrials
ChoriocarcinomaD002822EFO:0002893choriocarcinoma2ClinicalTrials
EpendymomaD004806EFO:1000028ependymoma2ClinicalTrials
GlioblastomaD005909EFO:0000519glioblastoma multiforme4ClinicalTrials
DailyMed
Inflammatory Breast NeoplasmsD058922EFO:1000984inflammatory breast carcinoma1ClinicalTrials
Lymphoma, Large B-Cell, DiffuseD016403EFO:0000403diffuse large B-cell lymphoma2ClinicalTrials
MesotheliomaD008654EFO:0000588mesothelioma2ClinicalTrials
NeoplasmsD009369EFO:0000616neoplasm4ATC
ClinicalTrials
PinealomaD010871EFO:1000475Pineoblastoma2ClinicalTrials
Prostatic NeoplasmsD011471EFO:0001663prostate carcinoma3ClinicalTrials
PterygiumD011625EFO:0000678pterygium3ClinicalTrials
ThymomaD013945EFO:1000581Thymoma2ClinicalTrials
Carcinoma, Non-Small-Cell LungD002289EFO:0003060non-small cell lung carcinoma4ClinicalTrials
Carcinoma, Renal CellD002292EFO:0000349clear cell renal carcinoma4ClinicalTrials
Carcinoma, Renal CellD002292EFO:0002890renal carcinoma4ClinicalTrials
Carcinoma, Renal CellD002292EFO:0003016collecting duct carcinoma4ClinicalTrials
Colorectal NeoplasmsD015179EFO:1001951colorectal carcinoma4ClinicalTrials
LeiomyosarcomaD007890EFO:0000564leiomyosarcoma2ClinicalTrials
Lung NeoplasmsD008175EFO:0001071lung carcinoma3ClinicalTrials
Lymphoma, FollicularD008224EFO:0000096neoplasm of mature B-cells3ClinicalTrials
MeningiomaD008579Orphanet:2495Meningioma2ClinicalTrials
Nasopharyngeal NeoplasmsD009303EFO:0004252nasopharyngeal neoplasm2ClinicalTrials
NeurilemmomaD009442EFO:0000693schwannoma1ClinicalTrials
OligodendrogliomaD009837EFO:0000630oligoastrocytoma2ClinicalTrials
Pancreatic NeoplasmsD010190EFO:0002618pancreatic carcinoma3ClinicalTrials
Peritoneal NeoplasmsD010534EFO:1001100peritoneal neoplasm1ClinicalTrials
Primary MyelofibrosisD055728EFO:0002430primary myelofibrosis2ClinicalTrials
RhabdomyosarcomaD012208EFO:0002918rhabdomyosarcoma2ClinicalTrials
Rhabdomyosarcoma, AlveolarD018232EFO:0000248alveolar rhabdomyosarcoma2ClinicalTrials
Sarcoma, KaposiD012514EFO:0000558Kaposi's sarcoma2ClinicalTrials
Triple Negative Breast NeoplasmsD064726EFO:0005537triple-negative breast cancer2ClinicalTrials
Urinary Bladder NeoplasmsD001749EFO:0000292bladder carcinoma2ClinicalTrials
von Hippel-Lindau DiseaseD006623Orphanet:892Von Hippel-Lindau disease0ClinicalTrials
AscitesD001201HP:0001541Ascites2ClinicalTrials
Colonic NeoplasmsD003110EFO:1001950colon carcinoma2ClinicalTrials
Colorectal NeoplasmsD015179EFO:0005842colorectal cancer4ClinicalTrials
Diabetic RetinopathyD003930EFO:0003770diabetic retinopathy3ClinicalTrials
Genital Neoplasms, FemaleD005833EFO:1001331Genital neoplasm, female2ClinicalTrials
HemorrhageD006470MP:0001914hemorrhage2ClinicalTrials
InflammationD007249MP:0001845inflammation3ClinicalTrials
LymphedemaD008209Orphanet:79383Lymphedema1ClinicalTrials
Neuromyelitis OpticaD009471EFO:0004256neuromyelitis optica1ClinicalTrials
Pancreatic NeoplasmsD010190EFO:0003860pancreatic neoplasm3ClinicalTrials
Prostatic NeoplasmsD011471EFO:0000196metastatic prostate cancer3ClinicalTrials
Prostatic NeoplasmsD011471EFO:0000673prostate adenocarcinoma3ClinicalTrials
Retinal Vein OcclusionD012170EFO:1001157retinal vein occlusion3ClinicalTrials
Retinopathy of PrematurityD012178EFO:1001158retinopathy of prematurity2ClinicalTrials
Sarcoma, SynovialD013584EFO:0001376synovial sarcoma2ClinicalTrials
Adrenocortical CarcinomaD018268EFO:0003093adrenocortical carcinoma2ClinicalTrials
Biliary Tract NeoplasmsD001661EFO:0003891biliary tract neoplasm2ClinicalTrials
Carcinoma, Pancreatic DuctalD021441EFO:0002517pancreatic ductal adenocarcinoma1ClinicalTrials
Carcinoma, Renal CellD002292EFO:0000681renal cell carcinoma4ClinicalTrials
DailyMed
Corneal NeovascularizationD016510EFO:1000880corneal neovascularization3ClinicalTrials
Esophageal NeoplasmsD004938EFO:0002916esophageal carcinoma2ClinicalTrials
Head and Neck NeoplasmsD006258EFO:0004284upper aerodigestive tract neoplasm2ClinicalTrials
Hodgkin DiseaseD006689EFO:0000183Hodgkins lymphoma2ClinicalTrials
Idiopathic Pulmonary FibrosisD054990EFO:0000768idiopathic pulmonary fibrosis2ClinicalTrials
LiposarcomaD008080EFO:0000569liposarcoma2ClinicalTrials
Macular DegenerationD008268EFO:0001365age-related macular degeneration3ClinicalTrials
MyopiaD009216HP:0000545Myopia3ClinicalTrials
Pulmonary Veno-Occlusive DiseaseD011668Orphanet:31837Pulmonary venoocclusive disease1ClinicalTrials
Spinal Cord NeoplasmsD013120EFO:0003828spinal cord neoplasm2ClinicalTrials
Stomach NeoplasmsD013274EFO:0000178gastric carcinoma3ClinicalTrials
Telangiectasia, Hereditary HemorrhagicD013683Orphanet:774Hereditary hemorrhagic telangiectasia3ClinicalTrials
Uterine Cervical NeoplasmsD002583EFO:0001061cervical carcinoma4ClinicalTrials
DailyMed

Clinical Data

ClinicalTrials.gov BEVACIZUMAB
The Cochrane Collaboration BEVACIZUMAB

HELM Notation

CHEMBL1201583 HELM Notation
PEPTIDE1{D.I.Q.M.T.Q.S.P.S.S.L.S.A.S.V.G.D.R.V.T.I.T.C.S.A.S.Q.D.I.S.N.Y.L.N.W.Y.Q.Q.K.P.G.K.A.P.K.V.L.I.Y.F.T.S.S.L.H.S.G.V.P.S.R.F.S.G.S.G.S.G.T.D.F.T.L.T.I.S.S.L.Q.P.E.D.F.A.T.Y.Y.C.Q.Q.Y.S.T.V.P.W.T.F.G.Q.G.T.K.V.E.I.K.R.T.V.A.A.P.S.V.F.I.F.P.P.S.D.E.Q.L.K.S.G.T.A.S.V.V.C.L.L.N.N.F.Y.P.R.E.A.K.V.Q.W.K.V.D.N.A.L.Q.S.G.N.S.Q.E.S.V.T.E.Q.D.S.K.D.S.T.Y.S.L.S.S.T.L.T.L.S.K.A.D.Y.E.K.H.K.V.Y.A.C.E.V.T.H.Q.G.L.S.S.P.V.T.K.S.F.N.R.G.E.C}|PEPTIDE2{E.V.Q.L.V.E.S.G.G.G.L.V.Q.P.G.G.S.L.R.L.S.C.A.A.S.G.Y.T.F.T.N.Y.G.M.N.W.V.R.Q.A.P.G.K.G.L.E.W.V.G.W.I.N.T.Y.T.G.E.P.T.Y.A.A.D.F.K.R.R.F.T.F.S.L.D.T.S.K.S.T.A.Y.L.Q.M.N.S.L.R.A.E.D.T.A.V.Y.Y.C.A.K.Y.P.H.Y.Y.G.S.S.H.W.Y.F.D.V.W.G.Q.G.T.L.V.T.V.S.S.A.S.T.K.G.P.S.V.F.P.L.A.P.S.S.K.S.T.S.G.G.T.A.A.L.G.C.L.V.K.D.Y.F.P.E.P.V.T.V.S.W.N.S.G.A.L.T.S.G.V.H.T.F.P.A.V.L.Q.S.S.G.L.Y.S.L.S.S.V.V.T.V.P.S.S.S.L.G.T.Q.T.Y.I.C.N.V.N.H.K.P.S.N.T.K.V.D.K.K.V.E.P.K.S.C.D.K.T.H.T.C.P.P.C.P.A.P.E.L.L.G.G.P.S.V.F.L.F.P.P.K.P.K.D.T.L.M.I.S.R.T.P.E.V.T.C.V.V.V.D.V.S.H.E.D.P.E.V.K.F.N.W.Y.V.D.G.V.E.V.H.N.A.K.T.K.P.R.E.E.Q.Y.N.S.T.Y.R.V.V.S.V.L.T.V.L.H.Q.D.W.L.N.G.K.E.Y.K.C.K.V.S.N.K.A.L.P.A.P.I.E.K.T.I.S.K.A.K.G.Q.P.R.E.P.Q.V.Y.T.L.P.P.S.R.E.E.M.T.K.N.Q.V.S.L.T.C.L.V.K.G.F.Y.P.S.D.I.A.V.E.W.E.S.N.G.Q.P.E.N.N.Y.K.T.T.P.P.V.L.D.S.D.G.S.F.F.L.Y.S.K.L.T.V.D.K.S.R.W.Q.Q.G.N.V.F.S.C.S.V.M.H.E.A.L.H.N.H.Y.T.Q.K.S.L.S.L.S.P.G.K}|PEPTIDE3{E.V.Q.L.V.E.S.G.G.G.L.V.Q.P.G.G.S.L.R.L.S.C.A.A.S.G.Y.T.F.T.N.Y.G.M.N.W.V.R.Q.A.P.G.K.G.L.E.W.V.G.W.I.N.T.Y.T.G.E.P.T.Y.A.A.D.F.K.R.R.F.T.F.S.L.D.T.S.K.S.T.A.Y.L.Q.M.N.S.L.R.A.E.D.T.A.V.Y.Y.C.A.K.Y.P.H.Y.Y.G.S.S.H.W.Y.F.D.V.W.G.Q.G.T.L.V.T.V.S.S.A.S.T.K.G.P.S.V.F.P.L.A.P.S.S.K.S.T.S.G.G.T.A.A.L.G.C.L.V.K.D.Y.F.P.E.P.V.T.V.S.W.N.S.G.A.L.T.S.G.V.H.T.F.P.A.V.L.Q.S.S.G.L.Y.S.L.S.S.V.V.T.V.P.S.S.S.L.G.T.Q.T.Y.I.C.N.V.N.H.K.P.S.N.T.K.V.D.K.K.V.E.P.K.S.C.D.K.T.H.T.C.P.P.C.P.A.P.E.L.L.G.G.P.S.V.F.L.F.P.P.K.P.K.D.T.L.M.I.S.R.T.P.E.V.T.C.V.V.V.D.V.S.H.E.D.P.E.V.K.F.N.W.Y.V.D.G.V.E.V.H.N.A.K.T.K.P.R.E.E.Q.Y.N.S.T.Y.R.V.V.S.V.L.T.V.L.H.Q.D.W.L.N.G.K.E.Y.K.C.K.V.S.N.K.A.L.P.A.P.I.E.K.T.I.S.K.A.K.G.Q.P.R.E.P.Q.V.Y.T.L.P.P.S.R.E.E.M.T.K.N.Q.V.S.L.T.C.L.V.K.G.F.Y.P.S.D.I.A.V.E.W.E.S.N.G.Q.P.E.N.N.Y.K.T.T.P.P.V.L.D.S.D.G.S.F.F.L.Y.S.K.L.T.V.D.K.S.R.W.Q.Q.G.N.V.F.S.C.S.V.M.H.E.A.L.H.N.H.Y.T.Q.K.S.L.S.L.S.P.G.K}|PEPTIDE4{D.I.Q.M.T.Q.S.P.S.S.L.S.A.S.V.G.D.R.V.T.I.T.C.S.A.S.Q.D.I.S.N.Y.L.N.W.Y.Q.Q.K.P.G.K.A.P.K.V.L.I.Y.F.T.S.S.L.H.S.G.V.P.S.R.F.S.G.S.G.S.G.T.D.F.T.L.T.I.S.S.L.Q.P.E.D.F.A.T.Y.Y.C.Q.Q.Y.S.T.V.P.W.T.F.G.Q.G.T.K.V.E.I.K.R.T.V.A.A.P.S.V.F.I.F.P.P.S.D.E.Q.L.K.S.G.T.A.S.V.V.C.L.L.N.N.F.Y.P.R.E.A.K.V.Q.W.K.V.D.N.A.L.Q.S.G.N.S.Q.E.S.V.T.E.Q.D.S.K.D.S.T.Y.S.L.S.S.T.L.T.L.S.K.A.D.Y.E.K.H.K.V.Y.A.C.E.V.T.H.Q.G.L.S.S.P.V.T.K.S.F.N.R.G.E.C}$PEPTIDE2,PEPTIDE2,267:R3-327:R3|PEPTIDE3,PEPTIDE3,267:R3-327:R3|PEPTIDE2,PEPTIDE3,232:R3-232:R3|PEPTIDE1,PEPTIDE1,23:R3-88:R3|PEPTIDE2,PEPTIDE2,373:R3-431:R3|PEPTIDE1,PEPTIDE1,134:R3-194:R3|PEPTIDE4,PEPTIDE4,23:R3-88:R3|PEPTIDE3,PEPTIDE3,150:R3-206:R3|PEPTIDE2,PEPTIDE3,235:R3-235:R3|PEPTIDE2,PEPTIDE2,150:R3-206:R3|PEPTIDE3,PEPTIDE3,22:R3-96:R3|PEPTIDE3,PEPTIDE4,226:R3-214:R3|PEPTIDE4,PEPTIDE4,134:R3-194:R3|PEPTIDE2,PEPTIDE1,226:R3-214:R3|PEPTIDE3,PEPTIDE3,373:R3-431:R3|PEPTIDE2,PEPTIDE2,22:R3-96:R3$$$

The ChEMBL HELM monomer library is available to download here.

For more details about HELM Notation, please visit the HELM Homepage.

Biological Sequence

Description Sequence
Bevacizumab heavy chain EVQLVESGGGLVQPGGSLRLSCAASGYTFTNYGMNWVRQAPGKGLEWVGWINTYTGEPTY AADFKRRFTFSLDTSKSTAYLQMNSLRAEDTAVYYCAKYPHYYGSSHWYFDVWGQGTLVT VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEL LGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPS REEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Bevacizumab light chain DIQMTQSPSSLSASVGDRVTITCSASQDISNYLNWYQQKPGKAPKVLIYFTSSLHSGVPS RFSGSGSGTDFTLTISSLQPEDFATYYCQQYSTVPWTFGQGTKVEIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Compound Cross References

ATC L - ANTINEOPLASTIC AND IMMUNOMODULATING AGENTS
L01 - ANTINEOPLASTIC AGENTS
L01X - OTHER ANTINEOPLASTIC AGENTS
L01XC - Monoclonal antibodies
L01XC07 - bevacizumab

ChemSpider ChemSpider Identifier not yet assigned
DailyMed bevacizumab
Wikipedia Bevacizumab
spacer
spacer