ChEMBL logo

ChEMBL

spacer
ChEMBL Statistics
  Loading Statistics...
spacer

Compound Report Card

Compound Name and Classification

Compound ID CHEMBL1201572
CHEMBL1201572
Compound Name ETANERCEPT
ChEMBL Synonyms BENEPALI | TNFR-IMMUNOADHESIN | L04AB01 | ETANERCEPT | ENBREL | RHU TNFR:FC
Max Phase 4 (Approved)
Trade Names BENEPALI | ENBREL

Sources

  • British National Formulary
  • Clinical Candidates
  • Manually Added Drugs
  • Scientific Literature
  • USP Dictionary of USAN and International Drug Names
  • WHO Anatomical Therapeutic Chemical Classification

Molecule Features

CHEMBL1201572 compound icon
Drug Type:Oligopeptide Rule of Five:N First In Class:N Chirality:Single Stereoisomer Prodrug:N Oral:N Parenteral:Y Topical:N Black Box:Y Availability Type:Prescription-only

Mechanism of Action

Mechanism of Action ChEMBL Target References
TNF-alpha inhibitor TNF-alpha DailyMed PubMed

Indications

MESH Heading MESH ID EFO ID EFO Term Max phase for indication References
Arthritis, JuvenileD001171EFO:0002609chronic childhood arthritis3ClinicalTrials
Arthritis, RheumatoidD001172EFO:0000685rheumatoid arthritis3ClinicalTrials
Myelodysplastic SyndromesD009190EFO:0000198myelodysplastic syndrome1ClinicalTrials
Sjogren's SyndromeD012859EFO:0000699Sjogren syndrome2ClinicalTrials
Stevens-Johnson SyndromeD013262EFO:0004276Stevens-Johnson syndrome3ClinicalTrials
Arthritis, PsoriaticD015535EFO:0003778psoriatic arthritis3ClinicalTrials
Diabetes Mellitus, Type 1D003922EFO:0001359type I diabetes mellitus3ClinicalTrials
Lupus Erythematosus, SystemicD008180EFO:0002690systemic lupus erythematosus2ClinicalTrials
Myositis, Inclusion BodyD018979EFO:0007323inclusion body myositis0ClinicalTrials
PneumoniaD011014EFO:0003106pneumonia3ClinicalTrials
UrticariaD014581EFO:0005531urticaria2ClinicalTrials
Granulomatosis with PolyangiitisD014890EFO:0005297Wegener's granulomatosis2ClinicalTrials
Renal Insufficiency, ChronicD051436EFO:0003884chronic kidney disease2ClinicalTrials
Spondylitis, AnkylosingD013167EFO:0003898ankylosing spondylitis3ClinicalTrials
Graft vs Host DiseaseD006086EFO:0004599acute graft vs. host disease3ClinicalTrials
Idiopathic Pulmonary FibrosisD054990EFO:0000768idiopathic pulmonary fibrosis2ClinicalTrials
Lichen PlanusD008010EFO:1000726lichen planus2ClinicalTrials
Mucocutaneous Lymph Node SyndromeD009080EFO:0004246mucocutaneous lymph node syndrome2ClinicalTrials
PsoriasisD011565EFO:0000676psoriasis3ClinicalTrials
Subarachnoid HemorrhageD013345EFO:0000713subarachnoid hemorrhage1ClinicalTrials
VitiligoD014820EFO:0004208Vitiligo2ClinicalTrials
Alzheimer DiseaseD000544EFO:0000249Alzheimers disease2ClinicalTrials
HistiocytosisD015614HP:0100727Histiocytosis2ClinicalTrials
Immune System DiseasesD007154EFO:0000540immune system disease4ATC
Lupus NephritisD008181EFO:0005761lupus nephritis2ClinicalTrials
NeoplasmsD009369EFO:0000616neoplasm1ClinicalTrials
PemphigusD010392EFO:0004719pemphigus vulgaris2ClinicalTrials
Pulmonary Disease, Chronic ObstructiveD029424EFO:0000341chronic obstructive pulmonary disease2ClinicalTrials
AsthmaD001249EFO:0000270asthma2ClinicalTrials
DermatomyositisD003882EFO:0000398dermatomyositis2ClinicalTrials
Hidradenitis SuppurativaD017497EFO:1000710hidradenitis suppurativa2ClinicalTrials
InflammationD007249MP:0001845inflammation2ClinicalTrials
LeukemiaD007938EFO:0000565leukemia2ClinicalTrials
Leukemia, Lymphocytic, Chronic, B-CellD015451EFO:0000095chronic lymphocytic leukemia1ClinicalTrials
Metabolic SyndromeD024821EFO:0000195metabolic syndrome2ClinicalTrials
Temporomandibular Joint DisordersD013705EFO:0005279temporomandibular joint disorder2ClinicalTrials
SciaticaD012585HP:0011868Sciatica1ClinicalTrials
StomatitisD013280EFO:1001904oral mucositis2ClinicalTrials
AmyloidosisD000686Orphanet:314701Primary systemic amyloidosis2ClinicalTrials
HIV InfectionsD015658EFO:0000764HIV infection1ClinicalTrials
Reperfusion InjuryD015427EFO:0002687ischemia reperfusion injury2ClinicalTrials

Clinical Data

ClinicalTrials.gov ETANERCEPT
The Cochrane Collaboration ETANERCEPT

Biological Sequence

Description Sequence
Tumor necrosis factor receptor superfamily member 1B precursor LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDST YTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRK CRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTS TSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGDEPKSC DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPQVKFNWYVD GVQVHNAKTKPREQQYNSTYRVVSVLTVLHQNWLDGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS DGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Tumor necrosis factor receptor superfamily member 1B precursor MAPVAVWAALAVGLELWAAAHALPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPG QHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTC RPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICR PHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTS FLLPMGPSPPAEGSTGDFALPVGLIVGVTALGLLIIGVVNCVIMTQVKKKPLCLQREAKV PHLPADKARGTQGPEQQHLLITAPSSSSSSLESSASALDRRAPTRNQPQAPGVEASGAGE ARASTGSSDSSPGGHGTQVNVTCIVNVCSSSDHSSQCSSQASSTMGDTDSSPSESPKDEQ VPFSKEECAFRSQLETPETLLGSTEEKPLPLGVPDAGMKPS

Compound Bioactivity Summary

Compound Assay Summary

Compound Target Summary

Compound Cross References

ATC L - ANTINEOPLASTIC AND IMMUNOMODULATING AGENTS
L04 - IMMUNOSUPPRESSANTS
L04A - IMMUNOSUPPRESSANTS
L04AB - Tumor necrosis factor alpha (TNF-α) inhibitors
L04AB01 - etanercept

ChemSpider ChemSpider Identifier not yet assigned
DailyMed etanercept
Wikipedia Etanercept
spacer
spacer