ChEMBL logo

ChEMBL

spacer
ChEMBL Statistics
  Loading Statistics...
spacer

Compound Report Card

Compound Name and Classification

Compound ID CHEMBL1201572
CHEMBL1201572
Compound Name ETANERCEPT
ChEMBL Synonyms TNFR-IMMUNOADHESIN | RHU TNFR:FC | L04AB01 | ENBREL | ETANERCEPT
Max Phase 4 (Approved)
Trade Names ENBREL

Sources

  • British National Formulary
  • Clinical Candidates
  • Manually Added Drugs
  • Scientific Literature
  • USP Dictionary of USAN and International Drug Names
  • WHO Anatomical Therapeutic Chemical Classification

Molecule Features

CHEMBL1201572 compound icon
Drug Type:Oligopeptide Rule of Five:N First In Class:N Chirality:Single Stereoisomer Prodrug:N Oral:N Parenteral:Y Topical:N Black Box:Y Availability Type:Prescription-only

Mechanism of Action

Mechanism of Action ChEMBL Target References
TNF-alpha inhibitor TNF-alpha DailyMed PubMed

Indications

MESH Heading MESH ID EFO ID EFO Term Max phase for indication References
MUCOCUTANEOUS LYMPH NODE SYNDROMED009080EFO:0004246MUCOCUTANEOUS LYMPH NODE SYNDROME2ClinicalTrials
ARTHRITIS, JUVENILED001171EFO:0002609CHRONIC CHILDHOOD ARTHRITIS3ClinicalTrials
GRAFT VS HOST DISEASED006086EFO:0004599ACUTE GRAFT VS. HOST DISEASE3ClinicalTrials
SCIATICAD012585HP:0011868SCIATICA1ClinicalTrials
MYOSITIS, INCLUSION BODYD018979EFO:0007323INCLUSION BODY MYOSITIS0ClinicalTrials
PSORIASISD011565EFO:0000676PSORIASIS3ClinicalTrials
DERMATOMYOSITISD003882EFO:0000398DERMATOMYOSITIS1ClinicalTrials
DIABETES MELLITUS, TYPE 1D003922EFO:0001359TYPE I DIABETES MELLITUS3ClinicalTrials
LICHEN PLANUSD008010EFO:1000726LICHEN PLANUS2ClinicalTrials
REPERFUSION INJURYD015427EFO:0002687ISCHEMIA REPERFUSION INJURY2ClinicalTrials
ALZHEIMER DISEASED000544EFO:0000249ALZHEIMERS DISEASE2ClinicalTrials
LEUKEMIAD007938EFO:0000565LEUKEMIA2ClinicalTrials
SUBARACHNOID HEMORRHAGED013345EFO:0000713SUBARACHNOID HEMORRHAGE1ClinicalTrials
HIDRADENITIS SUPPURATIVAD017497EFO:1000710HIDRADENITIS SUPPURATIVA2ClinicalTrials
RENAL INSUFFICIENCY, CHRONICD051436EFO:0003884CHRONIC KIDNEY DISEASE2ClinicalTrials
ARTHRITIS, RHEUMATOIDD001172EFO:0000685RHEUMATOID ARTHRITIS4ClinicalTrials
PNEUMONIAD011014EFO:0003106PNEUMONIA3ClinicalTrials
SPONDYLITIS, ANKYLOSINGD013167EFO:0003898ANKYLOSING SPONDYLITIS4ClinicalTrials
URTICARIAD014581EFO:0005531URTICARIA2ClinicalTrials

Clinical Data

ClinicalTrials.gov ETANERCEPT
The Cochrane Collaboration ETANERCEPT

Biological Sequence

Description Sequence
Tumor necrosis factor receptor superfamily member 1B precursor LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDST YTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRK CRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTS TSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGDEPKSC DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPQVKFNWYVD GVQVHNAKTKPREQQYNSTYRVVSVLTVLHQNWLDGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS DGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Tumor necrosis factor receptor superfamily member 1B precursor MAPVAVWAALAVGLELWAAAHALPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPG QHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTC RPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICR PHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTS FLLPMGPSPPAEGSTGDFALPVGLIVGVTALGLLIIGVVNCVIMTQVKKKPLCLQREAKV PHLPADKARGTQGPEQQHLLITAPSSSSSSLESSASALDRRAPTRNQPQAPGVEASGAGE ARASTGSSDSSPGGHGTQVNVTCIVNVCSSSDHSSQCSSQASSTMGDTDSSPSESPKDEQ VPFSKEECAFRSQLETPETLLGSTEEKPLPLGVPDAGMKPS

Compound Bioactivity Summary

Compound Assay Summary

Compound Target Summary

Compound Cross References

ATC L - ANTINEOPLASTIC AND IMMUNOMODULATING AGENTS
L04 - IMMUNOSUPPRESSANTS
L04A - IMMUNOSUPPRESSANTS
L04AB - Tumor necrosis factor alpha (TNF-α) inhibitors
L04AB01 - etanercept

ChemSpider ChemSpider Identifier not yet assigned
DailyMed etanercept
Wikipedia Etanercept
spacer
spacer