ChEMBL logo

ChEMBL

spacer
ChEMBL Statistics
  Loading Statistics...
spacer

Compound Report Card

Compound Name and Classification

Compound ID CHEMBL1201570
CHEMBL1201570
Compound Name ANAKINRA
ChEMBL Synonyms ANAKINRA | KINERET | ANTRIL
Max Phase 4 (Approved)
Trade Names ANTRIL | KINERET

Sources

  • British National Formulary
  • Manually Added Drugs
  • USP Dictionary of USAN and International Drug Names
  • WHO Anatomical Therapeutic Chemical Classification

Molecule Features

CHEMBL1201570 compound icon
Drug Type:Oligopeptide Rule of Five:N First In Class:N Chirality:Single Stereoisomer Prodrug:N Oral:N Parenteral:Y Topical:N Black Box:N Availability Type:Prescription-only

Mechanism of Action

Mechanism of Action ChEMBL Target References
Interleukin-1 receptor antagonist Interleukin-1 receptor DailyMed

Indications

MESH Heading MESH ID EFO ID EFO Term Max phase for indication References
Cryopyrin-Associated Periodic SyndromesD056587Orphanet:1451CINCA syndrome4DailyMed
Cryopyrin-Associated Periodic SyndromesD056587Orphanet:47045Familial cold urticaria4ClinicalTrials
Hepatitis, AlcoholicD006519EFO:1001345Hepatitis, Alcoholic2ClinicalTrials
Myocardial InfarctionD009203EFO:0000612myocardial infarction3ClinicalTrials
NeoplasmsD009369EFO:0000616neoplasm1ClinicalTrials
Smoldering Multiple MyelomaD000075122EFO:0003073asymptomatic myeloma1ClinicalTrials
Giant Cell ArteritisD013700EFO:1001209temporal arteritis3ClinicalTrials
Heart FailureD006333EFO:0003144heart failure2ClinicalTrials
Metabolic SyndromeD024821EFO:0000195metabolic syndrome3ClinicalTrials
Pancreatic NeoplasmsD010190EFO:0002618pancreatic carcinoma1ClinicalTrials
PolymyositisD017285EFO:0003063polymyositis2ClinicalTrials
UveitisD014605EFO:1001231uveitis2ClinicalTrials
Fatigue Syndrome, ChronicD015673EFO:0004540chronic fatigue syndrome2ClinicalTrials
Hidradenitis SuppurativaD017497EFO:1000710hidradenitis suppurativa2ClinicalTrials
Immune System DiseasesD007154EFO:0000540immune system disease4ATC
Arthritis, RheumatoidD001172EFO:0000685rheumatoid arthritis4ClinicalTrials
DailyMed
Familial Mediterranean FeverD010505Orphanet:342Familial Mediterranean fever3ClinicalTrials
Macrophage Activation SyndromeD055501EFO:1001806macrophage activation syndrome1ClinicalTrials
OsteoarthritisD010003EFO:0002506osteoarthritis2ClinicalTrials
Renal Insufficiency, ChronicD051436EFO:0003884chronic kidney disease2ClinicalTrials
Breast NeoplasmsD001943EFO:0000305breast carcinoma1ClinicalTrials
DermatomyositisD003882EFO:0000398dermatomyositis2ClinicalTrials
GoutD006073EFO:0004274gout2ClinicalTrials
MyocarditisD0092052ClinicalTrials
Amyotrophic Lateral SclerosisD000690EFO:0000253amyotrophic lateral sclerosis2ClinicalTrials
Arthritis, JuvenileD001171EFO:0002609chronic childhood arthritis2ClinicalTrials
Hearing LossD034381EFO:0004238hearing loss1ClinicalTrials
Diabetes MellitusD003920EFO:0000400diabetes mellitus2ClinicalTrials
Diabetes Mellitus, Type 1D003922EFO:0001359type I diabetes mellitus2ClinicalTrials
HIV InfectionsD015658EFO:0000764HIV infection1ClinicalTrials
Hypertension, PulmonaryD006976EFO:0001361pulmonary hypertension1ClinicalTrials
Myositis, Inclusion BodyD018979EFO:0007323inclusion body myositis2ClinicalTrials
Still's Disease, Adult-OnsetD016706EFO:0007135adult-onset Still's disease2ClinicalTrials
BlepharitisD0017621ClinicalTrials
Mucocutaneous Lymph Node SyndromeD009080EFO:0004246mucocutaneous lymph node syndrome2ClinicalTrials
Multiple MyelomaD009101EFO:0001378multiple myeloma2ClinicalTrials
NeoplasmsD009369EFO:0000311cancer1ClinicalTrials
PericarditisD010493EFO:0007427pericarditis0ClinicalTrials
Wounds and InjuriesD014947EFO:0000546injury2ClinicalTrials

Clinical Data

ClinicalTrials.gov ANAKINRA
The Cochrane Collaboration ANAKINRA

Biological Sequence

Description Sequence
Interleukin-1 receptor antagonist protein precursor MEICRGLRSHLITLLLFLFHSETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYL QGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQD KRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE

Compound Cross References

ATC L - ANTINEOPLASTIC AND IMMUNOMODULATING AGENTS
L04 - IMMUNOSUPPRESSANTS
L04A - IMMUNOSUPPRESSANTS
L04AC - Interleukin inhibitors
L04AC03 - anakinra

ChemSpider ChemSpider Identifier not yet assigned
DailyMed anakinra
Wikipedia Anakinra
spacer
spacer