ChEMBL logo

ChEMBL

spacer
ChEMBL Statistics
  Loading Statistics...
spacer

Compound Report Card

Compound Name and Classification

Compound ID CHEMBL1201567
CHEMBL1201567
Compound Name FILGRASTIM
ChEMBL Synonyms NIVESTIM | FILGRASTIM | NEUPOGEN | FILGRASTIM-SNDZ | ACCOFIL | NEUPOGEN 48 | TBO-FILGRASTIM | R-METHUG-CSF | ZARZIO | NEUPOGEN 30
Max Phase 4 (Approved)
Trade Names ACCOFIL | NEUPOGEN 48 | NEUPOGEN 30 | ZARZIO | NIVESTIM | NEUPOGEN

Sources

  • British National Formulary
  • Manually Added Drugs
  • Scientific Literature
  • USP Dictionary of USAN and International Drug Names
  • WHO Anatomical Therapeutic Chemical Classification

Molecule Features

CHEMBL1201567 compound icon
Drug Type:Oligopeptide Rule of Five:N First In Class:N Chirality:Single Stereoisomer Prodrug:N Oral:N Parenteral:Y Topical:N Black Box:N Availability Type:Prescription-only

Mechanism of Action

Mechanism of Action ChEMBL Target References
Granulocyte colony stimulating factor receptor agonist Granulocyte colony stimulating factor receptor DailyMed PubMed PubMed

Indications

MESH Heading MESH ID EFO ID EFO Term Max phase for indication References
Amyloidosis, FamilialD028226Orphanet:85443AL amyloidosis3ClinicalTrials
Breast NeoplasmsD001943EFO:0003869breast neoplasm3ClinicalTrials
Cerebral PalsyD002547EFO:1000632cerebral palsy2ClinicalTrials
Chagas CardiomyopathyD002598EFO:0005529Chagas cardiomyopathy3ClinicalTrials
Colorectal NeoplasmsD015179EFO:0004142colorectal neoplasm2ClinicalTrials
GliosarcomaD018316EFO:1001465gliosarcoma1ClinicalTrials
Hematologic NeoplasmsD019337EFO:0001642lymphoid neoplasm2ClinicalTrials
Leukemia, LymphoidD007945EFO:0004289lymphoid leukemia2ClinicalTrials
Leukemia, Monocytic, AcuteD007948EFO:0000221acute monocytic leukemia3ClinicalTrials
Lymphoma, Mantle-CellD020522EFO:1001469Mantle cell lymphoma3ClinicalTrials
MedulloblastomaD008527EFO:0002939medulloblastoma3ClinicalTrials
MelanomaD008545EFO:0000389cutaneous melanoma3ClinicalTrials
NeuroblastomaD009447EFO:0000621neuroblastoma3ClinicalTrials
Ovarian NeoplasmsD010051EFO:0001075ovarian carcinoma3ClinicalTrials
Pancreatic NeoplasmsD010190EFO:0002618pancreatic carcinoma2ClinicalTrials
Parkinson DiseaseD010300EFO:0002508Parkinson's disease2ClinicalTrials
Prostatic NeoplasmsD011471EFO:0000196metastatic prostate cancer3ClinicalTrials
Small Cell Lung CarcinomaD055752EFO:0000702small cell lung carcinoma2ClinicalTrials
Amyotrophic Lateral SclerosisD000690EFO:0000253amyotrophic lateral sclerosis2ClinicalTrials
Anemia, AplasticD000741HP:0001915aplastic anemia3ClinicalTrials
Carcinoma, Non-Small-Cell LungD002289EFO:0003060non-small cell lung carcinoma3ClinicalTrials
DiseaseD004194EFO:0000408disease1ClinicalTrials
LymphomaD008223EFO:0000574lymphoma3ClinicalTrials
Alzheimer DiseaseD000544EFO:0000249Alzheimers disease1ClinicalTrials
Anemia, AplasticD000741EFO:0006927severe aplastic anemia3ClinicalTrials
Cardiomyopathy, DilatedD002311EFO:0000407dilated cardiomyopathy2ClinicalTrials
Endometrial NeoplasmsD016889EFO:0004230endometrial neoplasm3ClinicalTrials
Esophageal NeoplasmsD004938EFO:0002916esophageal carcinoma2ClinicalTrials
Graft vs Host DiseaseD006086EFO:0004599acute graft vs. host disease3ClinicalTrials
Hematologic DiseasesD006402HP:0001871abnormality of blood and blood-forming tissues2ClinicalTrials
InfertilityD007246EFO:0000545infertility2ClinicalTrials
Inflammatory Breast NeoplasmsD058922EFO:1000984inflammatory breast carcinoma2ClinicalTrials
Leukemia, Mast-CellD007946EFO:0007359mast-cell leukemia2ClinicalTrials
Leukemia, Myelogenous, Chronic, BCR-ABL PositiveD015464EFO:0000339chronic myelogenous leukemia2ClinicalTrials
Liver CirrhosisD008103EFO:0001422cirrhosis of liver3ClinicalTrials
Multiple Sclerosis, Relapsing-RemittingD020529EFO:0003929relapsing-remitting multiple sclerosis3ClinicalTrials
NeoplasmsD009369EFO:0000616neoplasm3ClinicalTrials
Neuroectodermal Tumors, PrimitiveD018242EFO:0005235primitive neuroectodermal tumor3ClinicalTrials
PemphigusD010392EFO:0004719pemphigus vulgaris2ClinicalTrials
SarcomaD012509EFO:0000691sarcoma3ClinicalTrials
Carcinoma, HepatocellularD006528EFO:0000182hepatocellular carcinoma2ClinicalTrials
Colorectal NeoplasmsD015179EFO:1001951colorectal carcinoma2ClinicalTrials
Fanconi AnemiaD005199Orphanet:84Fanconi anemia2ClinicalTrials
GliomaD005910EFO:0000326central nervous system cancer3ClinicalTrials
LeukemiaD007938EFO:0000565leukemia3ClinicalTrials
Lymphoma, Large B-Cell, DiffuseD016403EFO:0000403diffuse large B-cell lymphoma3ClinicalTrials
Lymphoma, Non-HodgkinD008228EFO:0005952non-Hodgkins lymphoma3ClinicalTrials
Multiple SclerosisD009103EFO:0003885multiple sclerosis1ClinicalTrials
Myelodysplastic SyndromesD009190EFO:0000198myelodysplastic syndrome3ClinicalTrials
Myocardial InfarctionD009203EFO:0000612myocardial infarction3ClinicalTrials
NeutropeniaD0095033ClinicalTrials
Primary MyelofibrosisD055728EFO:0002430primary myelofibrosis1ClinicalTrials
Stomach NeoplasmsD013274EFO:0000178gastric carcinoma2ClinicalTrials
StrokeD020521EFO:0000712stroke2ClinicalTrials
Urethral NeoplasmsD014523EFO:0003846urethral neoplasm2ClinicalTrials
Urinary Bladder NeoplasmsD001749EFO:0000292bladder carcinoma3ClinicalTrials
Uterine Cervical NeoplasmsD002583EFO:0001061cervical carcinoma2ClinicalTrials
Anemia, Diamond-BlackfanD029503Orphanet:124Blackfan-Diamond anemia2ClinicalTrials
Breast NeoplasmsD001943EFO:0000305breast carcinoma3ClinicalTrials
Carcinoma, Renal CellD002292EFO:0000681renal cell carcinoma3ClinicalTrials
Carcinoma, Renal CellD002292EFO:0002890renal carcinoma3ClinicalTrials
Crohn DiseaseD003424EFO:0000384Crohn's disease1ClinicalTrials
Enterocolitis, NecrotizingD020345EFO:0003928necrotizing enterocolitis1ClinicalTrials
Hepatitis, AlcoholicD006519EFO:1001345Hepatitis, Alcoholic3ClinicalTrials
Leukemia, Basophilic, AcuteD015471EFO:0003029acute basophilic leukemia3ClinicalTrials
Leukemia, Lymphocytic, Chronic, B-CellD015451EFO:0000095chronic lymphocytic leukemia3ClinicalTrials
Lung NeoplasmsD008175EFO:0001071lung carcinoma3ClinicalTrials
OsteosarcomaD012516EFO:0000637osteosarcoma2ClinicalTrials
Prostatic NeoplasmsD011471EFO:0001663prostate carcinoma3ClinicalTrials
RetinoblastomaD012175Orphanet:790Retinoblastoma3ClinicalTrials
Scleroderma, SystemicD012595EFO:0000717systemic scleroderma2ClinicalTrials
Severe Combined ImmunodeficiencyD016511Orphanet:183660Severe combined immunodeficiency1ClinicalTrials
Anemia, RefractoryD000753EFO:0003802refractory anemia2ClinicalTrials
Epidermolysis Bullosa DystrophicaD016108Orphanet:303Dystrophic epidermolysis bullosa2ClinicalTrials
Head and Neck NeoplasmsD006258EFO:0006859head and neck malignant neoplasia3ClinicalTrials
Leukemia, Myeloid, AcuteD015470EFO:0000222acute myeloid leukemia3ClinicalTrials
Leukemia, Promyelocytic, AcuteD015473EFO:0000224acute promyelocytic leukemia1ClinicalTrials
Liver DiseasesD008107EFO:0001421liver disease3ClinicalTrials
Liver FailureD0170933ClinicalTrials
Lymphoma, Large-Cell, AnaplasticD017728EFO:0003032anaplastic large cell lymphoma2ClinicalTrials
NeoplasmsD009369EFO:0000311cancer3ClinicalTrials
Peripheral Vascular DiseasesD016491EFO:0003875peripheral vascular disease0ClinicalTrials
RhabdomyosarcomaD012208EFO:0002918rhabdomyosarcoma2ClinicalTrials
Burkitt LymphomaD002051EFO:0000309Burkitts lymphoma3ClinicalTrials
Diabetes Mellitus, Type 1D003922EFO:0001359type I diabetes mellitus2ClinicalTrials
End Stage Liver DiseaseD058625EFO:1001311End Stage Liver Disease3ClinicalTrials
Leukemia, Myeloid, AcuteD015470EFO:0003027acute myeloblastic leukemia without maturation3ClinicalTrials
MelanomaD008545EFO:0000756melanoma3ClinicalTrials
Multiple MyelomaD009101EFO:0001378multiple myeloma3ClinicalTrials
Muscular DystrophiesD009136Orphanet:98473Muscular dystrophy1ClinicalTrials
Nasopharyngeal NeoplasmsD009303EFO:0004252nasopharyngeal neoplasm2ClinicalTrials
Neoplasms, Germ Cell and EmbryonalD009373EFO:0000514germ cell tumor3ClinicalTrials
Peripheral Arterial DiseaseD058729EFO:0004265peripheral arterial disease1ClinicalTrials
Respiratory InsufficiencyD0121312ClinicalTrials
Uterine NeoplasmsD014594EFO:0003859uterine neoplasm3ClinicalTrials
Wilms TumorD009396Orphanet:654Nephroblastoma2ClinicalTrials
Adrenocortical CarcinomaD018268EFO:0003093adrenocortical carcinoma3ClinicalTrials
Breast Neoplasms, MaleD018567EFO:0006861male breast carcinoma2ClinicalTrials
Carcinoma, Squamous CellD002294EFO:0000181head and neck squamous cell carcinoma2ClinicalTrials
HIV InfectionsD015658EFO:0000764HIV infection2ClinicalTrials
Hodgkin DiseaseD006689EFO:0000183Hodgkins lymphoma3ClinicalTrials
Leukemia, Megakaryoblastic, AcuteD007947EFO:0003025acute megakaryoblastic leukaemia3ClinicalTrials
Leukemia, Myelomonocytic, AcuteD015479EFO:0000223acute myelomonocytic leukemia3ClinicalTrials
Leukemia, Plasma CellD007952EFO:0006475plasma cell leukemia1ClinicalTrials
Lupus Erythematosus, SystemicD008180EFO:0002690systemic lupus erythematosus2ClinicalTrials
Lymphoma, AIDS-RelatedD016483EFO:1001365Lymphoma, AIDS-Related2ClinicalTrials
Lymphoma, FollicularD008224EFO:0000096neoplasm of mature B-cells2ClinicalTrials
Lymphoma, T-Cell, PeripheralD016411EFO:0000211unspecified peripheral T-cell lymphoma2ClinicalTrials
Ovarian NeoplasmsD010051EFO:0003893ovarian neoplasm3ClinicalTrials
Precursor Cell Lymphoblastic Leukemia-LymphomaD054198EFO:0000220acute lymphoblastic leukemia3ClinicalTrials
Triple Negative Breast NeoplasmsD064726EFO:0005537triple-negative breast cancer3ClinicalTrials

Clinical Data

ClinicalTrials.gov FILGRASTIM
The Cochrane Collaboration FILGRASTIM

Biological Sequence

Description Sequence
Granulocyte colony-stimulating factor precursor MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAA LQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQG LLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRR AGGVLVASHLQSFLEVSYRVLRHLAQP

Compound Bioactivity Summary

Compound Assay Summary

Compound Target Summary

Compound Cross References

ATC L - ANTINEOPLASTIC AND IMMUNOMODULATING AGENTS
L03 - IMMUNOSTIMULANTS
L03A - IMMUNOSTIMULANTS
L03AA - Colony stimulating factors
L03AA02 - filgrastim

ChemSpider ChemSpider Identifier not yet assigned
DailyMed filgrastim filgrastim-sndz tbo-filgrastim
Wikipedia Filgrastim
spacer
spacer