ChEMBL logo

ChEMBL

spacer
ChEMBL Statistics
  Loading Statistics...
spacer

Compound Report Card

Compound Name and Classification

Compound ID CHEMBL1201566
CHEMBL1201566
Compound Name DARBEPOETIN ALFA
ChEMBL Synonyms DARBEPOETIN ALFA | NESP | ARANESP SURECLICK | ARANESP
Max Phase 4 (Approved)
Trade Names ARANESP SURECLICK | ARANESP

Sources

  • British National Formulary
  • Manually Added Drugs
  • USP Dictionary of USAN and International Drug Names
  • WHO Anatomical Therapeutic Chemical Classification

Molecule Features

CHEMBL1201566 compound icon
Drug Type:Oligopeptide Rule of Five:N First In Class:N Chirality:Single Stereoisomer Prodrug:N Oral:N Parenteral:Y Topical:N Black Box:Y Availability Type:Prescription-only

Mechanism of Action

Mechanism of Action ChEMBL Target References
Erythropoietin receptor agonist Erythropoietin receptor FDA PubMed

Indications

MESH Heading MESH ID EFO ID EFO Term Max phase for indication References
Kidney DiseasesD007674EFO:0003086kidney disease3ClinicalTrials
AnemiaD000740EFO:0004272anemia4ATC
ClinicalTrials
Renal Insufficiency, ChronicD051436EFO:0003884chronic kidney disease3ClinicalTrials
Brain IschemiaD002545HP:0002637Cerebral ischemia2ClinicalTrials
Small Cell Lung CarcinomaD055752EFO:0000702small cell lung carcinoma3ClinicalTrials
Breast NeoplasmsD001943EFO:0000305breast carcinoma3ClinicalTrials
Myelodysplastic SyndromesD009190EFO:0000198myelodysplastic syndrome3ClinicalTrials
Acute Kidney InjuryD058186HP:0001919Acute kidney injury2ClinicalTrials
LeukemiaD007938EFO:0000565leukemia2ClinicalTrials
LymphomaD008223EFO:0000574lymphoma2ClinicalTrials
Lymphoma, Large B-Cell, DiffuseD016403EFO:0000403diffuse large B-cell lymphoma3ClinicalTrials
NeoplasmsD009369EFO:0000311cancer3ClinicalTrials
Hematologic NeoplasmsD019337EFO:0001642lymphoid neoplasm2ClinicalTrials
Myocardial InfarctionD009203EFO:0000612myocardial infarction3ClinicalTrials
Wounds and InjuriesD014947EFO:0000546injury2ClinicalTrials

Clinical Data

ClinicalTrials.gov DARBEPOETIN ALFA
The Cochrane Collaboration DARBEPOETIN ALFA

Biological Sequence

Description Sequence
Erythropoietin precursor MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHC SLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQL HVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKL KLYTGEACRTGDR

Compound Cross References

ATC B - BLOOD AND BLOOD FORMING ORGANS
B03 - ANTIANEMIC PREPARATIONS
B03X - OTHER ANTIANEMIC PREPARATIONS
B03XA - Other antianemic preparations
B03XA02 - darbepoetin alfa

ChemSpider ChemSpider Identifier not yet assigned
DailyMed darbepoetin alfa
spacer
spacer