ChEMBL logo

ChEMBL

spacer
ChEMBL Statistics
  Loading Statistics...
spacer

Compound Report Card

Compound Name and Classification

Compound ID CHEMBL1201563
CHEMBL1201563
Compound Name INTERFERON BETA-1B
ChEMBL Synonyms INTERFERON BETA-1B | Extavia | BETASERON
Max Phase 4 (Approved)
Trade Names Extavia | BETASERON

Sources

  • Manually Added Drugs
  • USP Dictionary of USAN and International Drug Names
  • WHO Anatomical Therapeutic Chemical Classification

Molecule Features

CHEMBL1201563 compound icon
Drug Type:Oligopeptide Rule of Five:N First In Class:N Chirality:Single Stereoisomer Prodrug:N Oral:N Parenteral:Y Topical:N Black Box:N Availability Type:Prescription-only

Mechanism of Action

Mechanism of Action ChEMBL Target References
Interferon alpha/beta receptor agonist Interferon alpha/beta receptor DailyMed PubMed

Indications

MESH Heading MESH ID EFO ID EFO Term Max phase for indication References
Multiple SclerosisD009103EFO:0003885multiple sclerosis3ClinicalTrials
Multiple Sclerosis, Relapsing-RemittingD020529EFO:0003929relapsing-remitting multiple sclerosis3ClinicalTrials
HIV InfectionsD015658EFO:0000764HIV infection3ClinicalTrials
CardiomyopathiesD009202EFO:0000318cardiomyopathy2ClinicalTrials

Clinical Data

ClinicalTrials.gov INTERFERON BETA-1B
The Cochrane Collaboration INTERFERON BETA-1B

Biological Sequence

Description Sequence
Interferon beta precursor MTNKCLLQIALLLCFSTTALSMSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFD IPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLK TVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINR LTGYLRN

Compound Cross References

ATC L - ANTINEOPLASTIC AND IMMUNOMODULATING AGENTS
L03 - IMMUNOSTIMULANTS
L03A - IMMUNOSTIMULANTS
L03AB - Interferons
L03AB08 - interferon beta-1b

ChemSpider ChemSpider Identifier not yet assigned
DailyMed interferon beta-1b
Wikipedia Interferon_beta-1b
spacer
spacer