ChEMBL logo

ChEMBL

spacer
ChEMBL Statistics
  Loading Statistics...
spacer

Compound Report Card

Compound Name and Classification

Compound ID CHEMBL1201556
CHEMBL1201556
Compound Name BECAPLERMIN
ChEMBL Synonyms REGRANEX | BECAPLERMIN | RWJ 60235
Max Phase 4 (Approved)
Trade Names REGRANEX

Sources

  • British National Formulary
  • Manually Added Drugs
  • Scientific Literature
  • USP Dictionary of USAN and International Drug Names
  • WHO Anatomical Therapeutic Chemical Classification

Molecule Features

CHEMBL1201556 compound icon
Drug Type:Oligopeptide Rule of Five:N First In Class:N Chirality:Single Stereoisomer Prodrug:N Oral:N Parenteral:Y Topical:Y Black Box:Y Availability Type:Prescription-only

Mechanism of Action

Mechanism of Action ChEMBL Target References
Platelet-derived growth factor receptor agonist Platelet-derived growth factor receptor FDA

Indications

MESH Heading MESH ID EFO ID EFO Term Max phase for indication References
Diabetic FootD017719EFO:1001459diabetic foot1ClinicalTrials
Skin UlcerD012883HP:0200042Skin ulcer4ATC
ClinicalTrials

Clinical Data

ClinicalTrials.gov BECAPLERMIN
The Cochrane Collaboration BECAPLERMIN

Biological Sequence

Description Sequence
Platelet-derived growth factor, B chain precursor MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAEL DLNMTRSHSGGELESLARGRRSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLV WPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKC ETVAAARPVTRSPGGSQEQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLG A

Compound Bioactivity Summary

Compound Assay Summary

Compound Target Summary

Compound Cross References

ATC D - DERMATOLOGICALS
D03 - PREPARATIONS FOR TREATMENT OF WOUNDS AND ULCERS
D03A - CICATRIZANTS
D03AX - Other cicatrizants
D03AX06 - becaplermin

A - ALIMENTARY TRACT AND METABOLISM
A01 - STOMATOLOGICAL PREPARATIONS
A01A - STOMATOLOGICAL PREPARATIONS
A01AD - Other agents for local oral treatment
A01AD08 - becaplermin

ChemSpider ChemSpider Identifier not yet assigned
DailyMed becaplermin
Wikipedia Becaplermin
spacer
spacer