ChEMBL logo

ChEMBL

spacer
ChEMBL Statistics
  Loading Statistics...
spacer

Compound Report Card

Compound Name and Classification

Compound ID CHEMBL1201538
CHEMBL1201538
Compound Name INSULIN LISPRO
ChEMBL Synonyms INS HUMALOG | HUMALOG | HUMALOG PEN | INSULIN LISPRO RECOMBINANT | INSULIN LISPRO | HUMALOG KWIKPEN
Max Phase 4 (Approved)
Trade Names HUMALOG PEN | HUMALOG KWIKPEN | HUMALOG | INS HUMALOG

Sources

  • British National Formulary
  • Orange Book
  • USP Dictionary of USAN and International Drug Names
  • WHO Anatomical Therapeutic Chemical Classification

Molecule Features

CHEMBL1201538 compound icon
Drug Type:Oligopeptide Rule of Five:N First In Class:N Chirality:Single Stereoisomer Prodrug:N Oral:N Parenteral:Y Topical:N Black Box:N Availability Type:Prescription-only

Mechanism of Action

Mechanism of Action ChEMBL Target References
Insulin receptor agonist Insulin receptor DailyMed

Indications

MESH Heading MESH ID EFO ID EFO Term Max phase for indication References
Diabetes Mellitus, Type 1D003922EFO:0001359type I diabetes mellitus3ClinicalTrials
Diabetes MellitusD003920EFO:0000400diabetes mellitus4ATC
ATC
ClinicalTrials
Diabetes Mellitus, Type 2D003924EFO:0001360type II diabetes mellitus3ClinicalTrials
HyperglycemiaD006943HP:0003074Hyperglycemia3ClinicalTrials

Clinical Data

ClinicalTrials.gov INSULIN LISPRO
The Cochrane Collaboration INSULIN LISPRO

Biological Sequence

Description Sequence
Purified semisynthetic human insulin zinc suspension MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAED LQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN

Compound Cross References

ATC A - ALIMENTARY TRACT AND METABOLISM
A10 - DRUGS USED IN DIABETES
A10A - INSULINS AND ANALOGUES
A10AB - Insulins and analogues for injection, fast-acting
A10AB04 - insulin lispro

A - ALIMENTARY TRACT AND METABOLISM
A10 - DRUGS USED IN DIABETES
A10A - INSULINS AND ANALOGUES
A10AC - Insulins and analogues for injection, intermediate-acting
A10AC04 - insulin lispro

ChemSpider ChemSpider Identifier not yet assigned
DailyMed insulin lispro insulin lispro recombinant
spacer
spacer