ChEMBL logo

ChEMBL

spacer
ChEMBL Statistics
  Loading Statistics...
spacer

Compound Report Card

Compound Name and Classification

Compound ID CHEMBL1201497
CHEMBL1201497
Compound Name INSULIN GLARGINE
ChEMBL Synonyms TOUJEO SOLOSTAR | ABASAGLAR KWIKPEN | HOE 901 | ABASAGLAR | TOUJEO | Insulin glargine recombinant | BASAGLAR | INS LANTUS OPTICLIK | HOE 71GT | INS LANTUS OPTISET | LANTUS SOLOSTAR | LANTUS | INS LANTUS | INSULIN GLARGINE | INS LANTUS SOLOSTAR
Max Phase 4 (Approved)
Trade Names INS LANTUS OPTISET | LANTUS SOLOSTAR | INS LANTUS | LANTUS | ABASAGLAR KWIKPEN | BASAGLAR | TOUJEO | INS LANTUS OPTICLIK | ABASAGLAR | INS LANTUS SOLOSTAR | TOUJEO SOLOSTAR

Sources

  • British National Formulary
  • Orange Book
  • USP Dictionary of USAN and International Drug Names
  • WHO Anatomical Therapeutic Chemical Classification

Molecule Features

CHEMBL1201497 compound icon
Drug Type:Oligopeptide Rule of Five:N First In Class:N Chirality:Single Stereoisomer Prodrug:N Oral:N Parenteral:Y Topical:N Black Box:N Availability Type:Prescription-only

Mechanism of Action

Mechanism of Action ChEMBL Target References
Insulin receptor agonist Insulin receptor DailyMed

Indications

MESH Heading MESH ID EFO ID EFO Term Max phase for indication References
LymphomaD008223EFO:0000574lymphoma3ClinicalTrials
Diabetic RetinopathyD003930EFO:0003770diabetic retinopathy0ClinicalTrials
Myocardial InfarctionD009203EFO:0000612myocardial infarction3ClinicalTrials
LeukemiaD007938EFO:0000565leukemia3ClinicalTrials
Prediabetic StateD011236EFO:1001121prediabetes syndrome3ClinicalTrials
Diabetes Mellitus, Type 1D003922EFO:0001359type I diabetes mellitus4ClinicalTrials
DailyMed
DailyMed
DailyMed
DailyMed
Diabetes Mellitus, Type 2D003924EFO:0001360type II diabetes mellitus4ClinicalTrials
DailyMed
DailyMed
DailyMed
DailyMed
HyperglycemiaD006943HP:0003074Hyperglycemia3ClinicalTrials
Cystic FibrosisD003550Orphanet:586Cystic fibrosis3ClinicalTrials
Diabetes MellitusD003920EFO:0000400diabetes mellitus4ATC
ClinicalTrials

Clinical Data

ClinicalTrials.gov INSULIN GLARGINE
The Cochrane Collaboration INSULIN GLARGINE

Biological Sequence

Description Sequence
Purified semisynthetic human insulin zinc suspension MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAED LQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN

Compound Cross References

ATC A - ALIMENTARY TRACT AND METABOLISM
A10 - DRUGS USED IN DIABETES
A10A - INSULINS AND ANALOGUES
A10AE - Insulins and analogues for injection, long-acting
A10AE04 - insulin glargine

ChemSpider ChemSpider Identifier not yet assigned
DailyMed insulin glargine insulin glargine recombinant
spacer
spacer