ChEMBL logo

ChEMBL

spacer
ChEMBL Statistics
  Loading Statistics...
spacer

Compound Report Card

Compound Name and Classification

Compound ID CHEMBL1201464
CHEMBL1201464
Compound Name CHORIOGONADOTROPIN ALFA
ChEMBL Synonyms CHORIOGONADOTROPIN ALFA | OVIDREL | OVITRELLE | ATC CODE G03 GA GONADOTROPINS | CHORIONIC GONADOTROPHIN ALFA
Max Phase 4 (Approved)
Trade Names OVITRELLE | OVIDREL

Sources

  • British National Formulary
  • Orange Book
  • USP Dictionary of USAN and International Drug Names
  • WHO Anatomical Therapeutic Chemical Classification

Molecule Features

CHEMBL1201464 compound icon
Drug Type:Oligopeptide Rule of Five:N First In Class:N Chirality:Single Stereoisomer Prodrug:N Oral:N Parenteral:Y Topical:N Black Box:N Availability Type:Prescription-only

Mechanism of Action

Mechanism of Action ChEMBL Target References
Luteinizing hormone/Choriogonadotropin receptor agonist Luteinizing hormone/Choriogonadotropin receptor DailyMed

Indications

MESH Heading MESH ID EFO ID EFO Term Max phase for indication References
InfertilityD007246EFO:0000545infertility3ClinicalTrials
Ovarian Hyperstimulation SyndromeD016471Orphanet:64739Ovarian hyperstimulation syndrome3ClinicalTrials
Polycystic Ovary SyndromeD011085EFO:0000660polycystic ovary syndrome2ClinicalTrials

Clinical Data

ClinicalTrials.gov CHORIOGONADOTROPIN ALFA
The Cochrane Collaboration CHORIOGONADOTROPIN ALFA

Biological Sequence

Description Sequence
Choriogonadotropin beta chain SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYR DVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSS SKAPPPSLPSPSRLPGPSDTPILPQ
Glycoprotein hormones alpha chain APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCC VAKSYNRVTVMGGFKVENHTACHCSTCYYHKS

Compound Cross References

ATC G - GENITO URINARY SYSTEM AND SEX HORMONES
G03 - SEX HORMONES AND MODULATORS OF THE GENITAL SYSTEM
G03G - GONADOTROPINS AND OTHER OVULATION STIMULANTS
G03GA - Gonadotropins
G03GA08 - choriogonadotropin alfa

ChemSpider ChemSpider Identifier not yet assigned
DailyMed choriogonadotropin alfa
spacer
spacer