CHEBI:53000 - epitope

Main ChEBI Ontology Automatic Xrefs Reactions Pathways Models
ChEBI Name epitope
ChEBI ID CHEBI:53000
Definition The biological role played by a material entity when bound by a receptor of the adaptive immune system. Specific site on an antigen to which an antibody binds.
Stars This entity has been manually annotated by the ChEBI Team.
ChEBI Ontology
Outgoing epitope (CHEBI:53000) is a biological role (CHEBI:24432)
Incoming →3)-β-D-Galp-(1→3)-β-D-GalpNAc-(1→4)-[α-Neup5Ac-(2→8)-α-Neup5Ac-(2→8)-α-Neup5Ac-(2→3)]-β-D-Galp-yl group (CHEBI:133893) has role epitope (CHEBI:53000)
→4)-α-D-Galp-(1→4)-β-D-Galp-(1→4)-β-D-Glcp-yl group (CHEBI:142533) has role epitope (CHEBI:53000)
→8)-α-Neu5Ac-(2→3)-[β-D-Gal-(1→3)-β-D-GalNAc-(1→4)]-β-D-Gal-(1→4)-yl group (CHEBI:142514) has role epitope (CHEBI:53000)
Δ9-tetrahydrocannabinol (CHEBI:66964) has role epitope (CHEBI:53000)
α-N-acetylneuraminyl-(2→6)-β-D-galactosyl-(1→4)-N-acetyl-β-D-glucosamine (CHEBI:17725) has role epitope (CHEBI:53000)
α-D-Abep-(1→3)-α-D-Manp-(1→4)-α-L-Rhap-(1→3)-α-D-Galp (CHEBI:59404) has role epitope (CHEBI:53000)
α-D-Gal-(1→3)-β-D-Gal-(1→3)-β-D-GlcNAc (CHEBI:68476) has role epitope (CHEBI:53000)
α-D-Gal-(1→3)-β-D-Gal-(1→4)-β-D-GlcNAc-(1→2)-α-D-Man-(1→3)-[α-D-Gal-(1→3)-β-D-Gal-(1→4)-β-D-GlcNAc-(1→2)-α-D-Man-(1→6)]-β-D-Man-(1→4)-β-D-GlcNAc-(1→4)-β-D-GlcNAc (CHEBI:68480) has role epitope (CHEBI:53000)
α-D-Gal-(1→3)-β-D-Gal-(1→4)-[α-L-Fuc-(1→3)]-β-D-GlcNAc-(1→2)-α-D-Man-(1→3)-{α-D-Gal-(1→3)-β-D-Gal-(1→4)-[α-L-Fuc-(1→3)]-β-D-GlcNAc-(1→2)-α-D-Man-(1→6)}-β-D-Man-(1→4)-β-D-GlcNAc-(1→4)-β-D-GlcNAc (CHEBI:68470) has role epitope (CHEBI:53000)
α-D-Gal-(1→3)-[α-L-Fuc-(1→2)]-β-D-Gal (CHEBI:61010) has role epitope (CHEBI:53000)
α-D-Gal-(1→3)-[α-L-Fuc-(1→2)]-β-D-Gal-(1→3)-β-D-GlcNAc-(1→2)-α-D-Man-(1→3)-{α-D-Gal-(1→3)-[α-L-Fuc-(1→2)]-β-D-Gal-(1→3)-β-D-GlcNAc-(1→2)-α-D-Man-(1→6)}-β-D-Man-(1→4)-β-D-GlcNAc-(1→4)-β-D-GlcNAc (CHEBI:68466) has role epitope (CHEBI:53000)
α-D-Gal-(1→3)-[α-L-Fuc-(1→2)]-β-D-Gal-(1→4)-β-D-GlcNAc-(1→2)-α-D-Man-(1→3)-{α-D-Gal-(1→3)-[α-L-Fuc-(1→2)]-β-D-Gal-(1→4)-β-D-GlcNAc-(1→2)-α-D-Man-(1→6)}-β-D-Man-(1→4)-β-D-GlcNAc-(1→4)-β-D-GlcNAc (CHEBI:68468) has role epitope (CHEBI:53000)
α-D-Gal-(1→3)-[α-L-Fuc-(1→2)]-β-D-Gal-(1→4)-D-GlcNAc (CHEBI:62099) has role epitope (CHEBI:53000)
α-D-Galp-(1→2)-[α-D-Abep-(1→3)]-α-D-Manp (CHEBI:59319) has role epitope (CHEBI:53000)
α-D-Galp-(1→2)-[α-D-Abep-(1→3)]-α-D-Manp-(1→4)-α-L-Rhap (CHEBI:59400) has role epitope (CHEBI:53000)
α-D-Galp-(1→2)-[α-D-Tyvp-(1→3)]-α-D-Manp-(1→4)-α-L-Rhap-(1→3)-α-D-Galp-(1→2)-[α-D-Tyvp-(1→3)]-α-D-Manp-(1→4)-α-L-Rhap (CHEBI:60321) has role epitope (CHEBI:53000)
α-D-Galp-(1→2)-[α-Abep-(1→3)]-α-D-Manp-(1→4)-α-L-Rhap-(1→3)-α-D-Galp-(1→2)-[α-Abep-(1→3)]-α-D-Manp-(1→4)-α-L-Rhap (CHEBI:59868) has role epitope (CHEBI:53000)
α-D-Galp-(1→3)-β-D-Galp-(1→4)-β-D-GlcpNAc (CHEBI:62327) has role epitope (CHEBI:53000)
α-D-Galp-(1→3)-β-D-Galp-(1→4)-β-D-GlcpNAc-yl group (CHEBI:12308) has role epitope (CHEBI:53000)
α-D-Galp-(1→3)-β-D-Galp-(1→4)-D-GlcpNAc-yl group (CHEBI:17785) has role epitope (CHEBI:53000)
α-D-Galp-(1→3)-β-D-Galp-(1→4)-[α-L-Fucp-(1→3)]-β-D-GlcpNAc (CHEBI:68477) has role epitope (CHEBI:53000)
α-D-Galp-(1→3)-[α-D-Galp-(1→4)]-β-D-Galp-(1→4)-β-D-GlcpNAc (CHEBI:68475) has role epitope (CHEBI:53000)
α-D-Galp-(1→3)-[α-L-Fucp-(1→2)]-β-D-Galp-(1→3)-β-D-GlcpNAc (CHEBI:63242) has role epitope (CHEBI:53000)
α-D-Galp-(1→3)-[α-L-Fucp-(1→2)]-β-D-Galp-(1→4)-β-D-Glcp (CHEBI:68474) has role epitope (CHEBI:53000)
α-D-Galp-(1→3)-[α-L-Fucp-(1→2)]-β-D-Galp-(1→4)-[α-L-Fucp-(1→3)]-β-D-GlcpNAc (CHEBI:68473) has role epitope (CHEBI:53000)
α-D-Galp-(1→4)-β-D-Galp-(1→4)-β-D-Glcp (CHEBI:68485) has role epitope (CHEBI:53000)
α-D-Galp-(1→4)-β-D-Galp-(1→4)-β-D-Glcp-yl group (CHEBI:142567) has role epitope (CHEBI:53000)
α-D-Galp-(1→4)-β-D-GalpNAc-(1→3)-D-Galp (CHEBI:60928) has role epitope (CHEBI:53000)
α-D-Galp-(1→4)-β-D-GlcpNAc (CHEBI:61836) has role epitope (CHEBI:53000)
α-D-Galp-(1→4)-[α-L-Fucp-(1→2)]-β-D-Galp-(1→4)-β-D-GlcpNAc (CHEBI:68482) has role epitope (CHEBI:53000)
α-D-GalpN-(1→4)-α-D-GalpA-yl group (CHEBI:136363) has role epitope (CHEBI:53000)
α-D-GalpNAc-(1→3)-β-D-Galp (CHEBI:62335) has role epitope (CHEBI:53000)
α-D-GalpNAc-(1→3)-[α-L-Fucp-(1→2)]-β-D-Galp (CHEBI:61012) has role epitope (CHEBI:53000)
α-D-GalpNAc-(1→3)-[α-L-Fucp-(1→2)]-β-D-Galp-(1→3)-β-D-GlcpNAc (CHEBI:62485) has role epitope (CHEBI:53000)
α-D-GalpNAc-(1→3)-[α-L-Fucp-(1→2)]-β-D-Galp-(1→4)-β-D-Glcp (CHEBI:62364) has role epitope (CHEBI:53000)
α-D-GalpNAc-(1→3)-[α-L-Fucp-(1→2)]-β-D-Galp-(1→4)-β-D-GlcpNAc (CHEBI:62486) has role epitope (CHEBI:53000)
α-D-GalpNAc-(1→3)-[α-L-Fucp-(1→2)]-β-D-Galp-(1→4)-β-D-GlcpNAc-(1→3)-β-D-Galp-(1→4)-β-D-GlcpNAc (CHEBI:68430) has role epitope (CHEBI:53000)
α-D-GalpNAc-(1→3)-[α-L-Fucp-(1→2)]-β-D-Galp-yl group (CHEBI:142571) has role epitope (CHEBI:53000)
α-D-GalpNAc-(1→4)-[α-D-Fucp-(1→2)]-β-D-Galp-(1→4)-β-D-GlcpNAc (CHEBI:68435) has role epitope (CHEBI:53000)
α-D-galactosyl-(1→2)-α-D-galactose (CHEBI:60179) has role epitope (CHEBI:53000)
α-D-galactosyl-(1→2)-β-D-galactose (CHEBI:64527) has role epitope (CHEBI:53000)
α-D-galactosyl-(1→2)-D-galactose (CHEBI:59432) has role epitope (CHEBI:53000)
α-D-galactosyl-(1→2)-D-galactosyl group (CHEBI:59431) has role epitope (CHEBI:53000)
α-D-galactosyl-(1→3)-α-D-galactose (CHEBI:60180) has role epitope (CHEBI:53000)
α-D-galactosyl-(1→3)-β-D-mannose (CHEBI:59430) has role epitope (CHEBI:53000)
α-D-galactosyl-(1→3)-D-galactose (CHEBI:53651) has role epitope (CHEBI:53000)
α-D-galactosyl-(1→3)-D-galactosyl group (CHEBI:59095) has role epitope (CHEBI:53000)
α-D-GalNpAc-(1→3)-β-D-GalpNAc (CHEBI:42528) has role epitope (CHEBI:53000)
α-D-GalNAc-(1→2)-β-D-Man-(1→4)-[β-D-Glc-(1→2)]-α-D-Man-(1→5)-α-Kdo (CHEBI:76000) has role epitope (CHEBI:53000)
α-D-GalNAc-(1→3)-[α-L-Fuc-(1→2)]-β-D-Gal-(1→3)-β-D-GlcNAc-(1→2)-α-D-Man-(1→3)-{α-D-GalNAc-(1→3)-[α-L-Fuc-(1→2)]-β-D-Gal-(1→3)-β-D-GlcNAc-(1→2)-α-D-Man-(1→6)}-β-D-Man-(1→4)-β-D-GlcNAc-(1→4)-β-D-GlcNAc (CHEBI:67220) has role epitope (CHEBI:53000)
α-D-GalNAc-(1→3)-[α-L-Fuc-(1→2)]-β-D-Gal-(1→4)-β-D-GlcNAc-(1→2)-α-D-Man-(1→3)-{α-D-GalNAc-(1→3)-[α-L-Fuc-(1→2)]-β-D-Gal-(1→4)-β-D-GlcNAc-(1→2)-α-DMan-(1→6)}-β-D-Man-(1→4)-β-D-GlcNAc-(1→4)-β-D-GlcNAc (CHEBI:68429) has role epitope (CHEBI:53000)
α-D-Glcp-(1→3)-α-L-Rhap (CHEBI:61806) has role epitope (CHEBI:53000)
α-D-Glcp-(1→6)-α-D-Glcp-(1→6)-β-D-Glcp (CHEBI:71421) has role epitope (CHEBI:53000)
α-D-GlcpNAc-(1→3)-β-D-Galp-(1→4)-β-D-GlcpNAc (CHEBI:71269) has role epitope (CHEBI:53000)
α-D-GlcpNAc-(1→4)-β-D-Galp-(1→3)-β-D-GlcpNAc (CHEBI:71273) has role epitope (CHEBI:53000)
α-D-GlcpNAc-(1→4)-β-D-Galp-(1→3)-D-GalpNAc (CHEBI:71270) has role epitope (CHEBI:53000)
α-D-GlcpNAc-(1→4)-β-D-Galp-(1→4)-β-D-GlcpNAc (CHEBI:71276) has role epitope (CHEBI:53000)
α-D-GlcpNAc-(1→4)-β-D-Galp-(1→4)-β-D-GlcpNAc-(1→3)-β-D-Galp-(1→4)-β-D-Glcp (CHEBI:71282) has role epitope (CHEBI:53000)
α-D-GlcpNAc-(1→4)-β-D-Galp-(1→4)-β-D-GlcpNAc-(1→3)-β-D-Galp-(1→4)-β-D-GlcpNAc (CHEBI:71289) has role epitope (CHEBI:53000)
α-D-GlcpNAc-(1→4)-β-D-Galp-(1→4)-β-D-GlcpNAc-(1→3)-β-D-Galp-(1→4)-β-D-GlcpNAc-(1→3)-β-D-Galp-(1→4)-β-D-GlcpNAc (CHEBI:71318) has role epitope (CHEBI:53000)
α-D-GlcpNAc-(1→4)-β-D-Galp-(1→4)-β-D-GlcpNAc-(1→3)-β-D-Galp-(1→4)-[α-L-Fucp-(1→3)]-β-D-GlcpNAc-(1→3)-β-D-Galp-(1→4)-[α-L-Fucp-(1→3)]-β-D-GlcpNAc (CHEBI:71319) has role epitope (CHEBI:53000)
α-D-GlcpNAc-(1→6)-β-D-Galp-(1→4)-β-D-GlcpNAc (CHEBI:71323) has role epitope (CHEBI:53000)
α-D-Kdo-(2→4)-α-D-Kdo-(2→4)-α-D-Kdo (CHEBI:59307) has role epitope (CHEBI:53000)
α-D-Kdo-(2→4)-α-D-Kdo-(2→4)-α-D-Kdo-(2→6)-β-D-GlcNAc (CHEBI:59303) has role epitope (CHEBI:53000)
α-D-Kdo-(2→4)-α-D-Kdo-(2→4)-α-D-Kdo-(2→6)-β-D-GlcNAc-4P-(1→6)-α-D-GlcNAc (CHEBI:60381) has role epitope (CHEBI:53000)
α-D-Kdo-(2→4)-α-D-Kdo-(2→8)-α-D-Kdo-(2→4)-α-D-Kdo (CHEBI:59306) has role epitope (CHEBI:53000)
α-D-Kdo-(2→8)-α-D-Kdo-(2→4)-α-D-Kdo-(2→6)-β-D-GlcNAc-(1→6)-α-D-GlcNAc (CHEBI:60483) has role epitope (CHEBI:53000)
α-D-Kdo-(2→8)-α-D-Kdo-(2→4)-α-D-Kdo-(2→6)-β-D-GlcNAc-4P-(1→6)-α-D-GlcNAc (CHEBI:60380) has role epitope (CHEBI:53000)
α-D-Kdo-(2→8)-α-D-Kdo-(2→6)-β-D-GlcNAc (CHEBI:59300) has role epitope (CHEBI:53000)
α-D-Kdo-(2→8)-[α-D-Kdo-(2→4)]-α-D-Kdo-(2→4)-α-D-Kdo (CHEBI:60382) has role epitope (CHEBI:53000)
α-D-Kdo-(2→8)-[α-D-Kdo-(2→4)]-α-D-Kdo-(2→4)-α-D-Kdo-(2→6)-β-D-GlcN-4P-(1→6)-α-D-GlcN-1P (CHEBI:60383) has role epitope (CHEBI:53000)
α-D-Kdo-(2→8)-[α-D-Kdo-(2→4)]-α-D-Kdo-(2→4)-α-D-Kdo-(2→6)-β-D-GlcNAc4P-(1→6)-α-D-GlcNAc (CHEBI:60391) has role epitope (CHEBI:53000)
α-D-Man-(1→2)-α-D-Man-(1→2)-α-D-Man-(1→3)-[α-D-Man-(1→3)-[α-D-Man-(1→2)-α-D-Man-(1→6)]-α-D-Man-(1→6)]-β-D-Man-(1→4)-β-D-GlcNAc-(1→4)-β-D-GlcNAc (CHEBI:71482) has role epitope (CHEBI:53000)
α-D-Manp-(1→2)-α-D-Manp-(1→2)-α-D-Manp-(1→2)-D-Manp (CHEBI:59249) has role epitope (CHEBI:53000)
α-D-Manp-(1→2)-α-D-Manp-(1→2)-α-D-Manp-(1→3)-α-D-Manp (CHEBI:71475) has role epitope (CHEBI:53000)
α-D-Manp-(1→2)-α-D-Manp-(1→2)-α-D-Manp-(1→3)-[α-D-Manp-(1→2)-α-D-Manp-(1→3)-[α-D-Manp-(1→2)-α-D-Manp-(1→6)]-α-D-Manp-(1→6)]-α-D-Manp (CHEBI:71471) has role epitope (CHEBI:53000)
α-D-Manp-(1→2)-α-D-Manp-(1→2)-α-D-Manp-(1→3)-[α-D-Manp-(1→3)-[α-D-Manp-(1→2)-α-D-Manp-(1→6)]-α-D-Manp-(1→6)]-α-D-Manp (CHEBI:71474) has role epitope (CHEBI:53000)
α-D-Manp-(1→2)-α-D-Manp-(1→3)-α-D-Manp (CHEBI:71479) has role epitope (CHEBI:53000)
α-D-Manp-(1→2)-α-D-Manp-(1→3)-[α-D-Manp-(1→2)-α-D-Manp-(1→6)]-α-D-Manp (CHEBI:71478) has role epitope (CHEBI:53000)
α-D-Manp-(1→2)-α-D-Manp-(1→3)-[α-D-Manp-(1→3)-[α-D-Manp-(1→6)]-α-D-Manp-(1→6)]-β-D-Manp-(1→4)-β-D-GlcpNAc-(1→4)-β-D-GlcpNAc (CHEBI:71518) has role epitope (CHEBI:53000)
α-D-Manp-(1→3)-[α-D-Manp-(1→2)-α-D-Manp-(1→2)-α-DManp-(1→6)]-α-D-Manp (CHEBI:71486) has role epitope (CHEBI:53000)
α-D-Manp-(1→3)-[α-D-Manp-(1→3)-[α-D-Manp-(1→6)]-α-D-Manp-(1→6)]-β-D-Manp (CHEBI:71503) has role epitope (CHEBI:53000)
α-D-Manp-(1→3)-[α-D-Manp-(1→3)-[α-D-Manp-(1→6)]-α-D-Manp-(1→6)]-β-D-Manp-(1→4)-β-D-GlcpNAc-(1→4)-β-D-GlcpNAc (CHEBI:71514) has role epitope (CHEBI:53000)
α-D-Manp-(1→3)-[α-D-Manp-(1→6)]-β-D-Manp-(1→4)-β-D-GlcpNAc-(1→4)-β-D-GlcpNAc (CHEBI:71495) has role epitope (CHEBI:53000)
α-D-Manp-(1→3)-[α-Neup5Ac-(2→6)-β-D-Galp-(1→4)-β-D-GlcpNAc-(1→2)-α-D-Manp-(1→6)]-β-D-Manp-(1→4)-β-D-GlcpNAc-(1→4)-D-GlcpNAc (CHEBI:71496) has role epitope (CHEBI:53000)
α-D-Manp-(1→6)-β-D-Manp (CHEBI:71552) has role epitope (CHEBI:53000)
α-D-Manp6P-(1→3)-α-D-Manp-(1→3)-α-D-Manp-(1→3)-α-D-Manp-(1→2)-D-Manp (CHEBI:90766) has role epitope (CHEBI:53000)
α-D-mannose (CHEBI:28729) has role epitope (CHEBI:53000)
α-D-mannose 6-phosphate (CHEBI:43896) has role epitope (CHEBI:53000)
α-D-Rhap-(1→2)-α-D-Rhap-(1→3)-α-D-Rhap (CHEBI:62056) has role epitope (CHEBI:53000)
α-D-Rhap-(1→3)-α-D-Rhap (CHEBI:62068) has role epitope (CHEBI:53000)
α-D-Rhap-(1→3)-α-D-Rhap-(1→2)-α-D-Rhap (CHEBI:62058) has role epitope (CHEBI:53000)
α-D-Rhap4NFo-(1→2)-α-D-Rhap4NFo-(1→2)-α-D-Rhap4NFo-(1→2)-α-D-Rhap4NFo (CHEBI:84748) has role epitope (CHEBI:53000)
α-D-Rhap4NFo-(1→3)-α-D-Rhap4NFo (CHEBI:84766) has role epitope (CHEBI:53000)
α-L-Araf-(1→2)-β-D-Galp-(1→3)-β-D-Galp6P-(1→4)-α-D-Manp (CHEBI:59617) has role epitope (CHEBI:53000)
α-L-Fuc-(1→2)-β-D-Gal-(1→4)-[α-L-Fuc-(1→3)]-β-D-GlcNAc-(1→2)-α-D-Man-(1→3)-[α-L-Fuc-(1→2)-β-D-Gal-(1→4)-[α-L-Fuc-(1→3)]-β-D-GlcNAc-(1→2)-α-D-Man-(1→6)]-β-D-Man-(1→4)-β-D-GlcNAc-(1→4)-D-GlcNAc (CHEBI:67157) has role epitope (CHEBI:53000)
α-L-Fuc-(1→2)-β-D-Gal-(1→4)-[α-L-Fuc-(1→3)]-β-D-GlcNAc-(1→3)-β-D-Gal-(1→4)-[α-L-Fuc-(1→3)]GlcNAc-(1→3)-β-D-Gal-(1→4)-[α-L-Fuc-(1→3)]-β-D-GlcNAc (CHEBI:67160) has role epitope (CHEBI:53000)
α-L-Fuc-(1→3)-β-D-GalNAc-(1→4)-β-D-GlcNAc-yl group (CHEBI:62189) has role epitope (CHEBI:53000)
α-L-Fuc-(1→3)-[β-D-Gal-(1→4)]-β-D-GlcNAc-(1→2)-α-D-Man-(1→3)-[α-L-Fuc-(1→3)-[β-D-Gal-(1→4)]-β-D-GlcNAc-(1→2)-α-D-Man-(1→6)]-β-D-Man-(1→4)-β-D-GlcNAc-(1→4)-β-D-GlcNAc (CHEBI:67165) has role epitope (CHEBI:53000)
α-L-Fucp-(1→2)-β-D-Galp (CHEBI:61529) has role epitope (CHEBI:53000)
α-L-Fucp-(1→2)-β-D-Galp-(1→3)-α-D-GalpNAc (CHEBI:62152) has role epitope (CHEBI:53000)
α-L-Fucp-(1→2)-β-D-Galp-(1→3)-α-D-GalpNAc-yl group (CHEBI:88101) has role epitope (CHEBI:53000)
α-L-Fucp-(1→2)-β-D-Galp-(1→3)-β-D-GalpNAc-(1→3)-α-D-Galp (CHEBI:65225) has role epitope (CHEBI:53000)
α-L-Fucp-(1→2)-β-D-Galp-(1→3)-β-D-GalpNAc-(1→3)-α-D-Galp-(1→4)-β-D-Galp-(1→4)-β-D-Glcp (CHEBI:65245) has role epitope (CHEBI:53000)
α-L-Fucp-(1→2)-β-D-Galp-(1→3)-β-D-GalpNAc-(1→4)-[α-Neup5Ac-(2→3)]-β-D-Galp-(1→4)-β-D-Glcp (CHEBI:62686) has role epitope (CHEBI:53000)
α-L-Fucp-(1→2)-β-D-Galp-(1→3)-β-D-GalpNAc-yl group (CHEBI:88103) has role epitope (CHEBI:53000)
α-L-Fucp-(1→2)-β-D-Galp-(1→3)-β-D-GlcpNAc (CHEBI:59296) has role epitope (CHEBI:53000)
α-L-Fucp-(1→2)-β-D-Galp-(1→3)-β-D-GlcpNAc-(1→2)-α-D-Manp-(1→3)-[α-L-Fucp-(1→2)-β-D-Galp-(1→3)-β-D-GlcpNAc-(1→2)-α-D-Manp-(1→6)]-β-D-Manp-(1→4)-β-D-GlcpNAc-(1→4)-β-D-GlcpNAc (CHEBI:65269) has role epitope (CHEBI:53000)
α-L-Fucp-(1→2)-β-D-Galp-(1→3)-β-D-GlcpNAc-(1→3)-β-D-Galp-(1→4)-β-D-Glcp (CHEBI:65276) has role epitope (CHEBI:53000)
α-L-Fucp-(1→2)-β-D-Galp-(1→3)-β-D-GlcpNAc-(1→3)-β-D-Galp-(1→4)-β-D-GlcpNAc-(1→3)-β-D-Galp-(1→4)-β-D-GlcpNAc (CHEBI:67163) has role epitope (CHEBI:53000)
α-L-Fucp-(1→2)-β-D-Galp-(1→3)-β-D-GlcpNAc-(1→3)-{α-L-Fucp-(1→3)-[β-D-Galp-(1→4)]-β-D-GlcpNAc-(1→6)}-β-D-Galp-(1→4)-β-D-Glcp (CHEBI:65278) has role epitope (CHEBI:53000)
α-L-Fucp-(1→2)-β-D-Galp-(1→3)-β-D-GlcpNAc-yl group (CHEBI:88085) has role epitope (CHEBI:53000)
α-L-Fucp-(1→2)-β-D-Galp-(1→3)-D-GlcpNAc (CHEBI:62259) has role epitope (CHEBI:53000)
α-L-Fucp-(1→2)-β-D-Galp-(1→3)-[α-L-Fucp-(1→4)]-β-D-GlcpNAc (CHEBI:59441) has role epitope (CHEBI:53000)
α-L-Fucp-(1→2)-β-D-Galp-(1→3)-[α-L-Fucp-(1→4)]-β-D-GlcpNAc-(1→2)-α-D-Manp-(1→3)-[α-L-Fucp-(1→2)-β-D-Galp-(1→3)-[α-L-Fucp-(1→4)]-β-D-GlcpNAc-(1→2)-α-D-Manp-(1→6)]-β-D-Manp-(1→4)-β-D-GlcpNAc-(1→4)-β-D-GlcpNAc (CHEBI:65199) has role epitope (CHEBI:53000)
α-L-Fucp-(1→2)-β-D-Galp-(1→3)-[α-L-Fucp-(1→4)]-β-D-GlcpNAc-yl group (CHEBI:88160) has role epitope (CHEBI:53000)
α-L-Fucp-(1→2)-β-D-Galp-(1→3)-[α-L-Fucp-(1→4)]-D-GlcNAc (CHEBI:59440) has role epitope (CHEBI:53000)
α-L-Fucp-(1→2)-β-D-Galp-(1→4)-β-D-GlcpNAc-(1→3)-β-D-Galp-(1→4)-D-GlcpNAc (CHEBI:67164) has role epitope (CHEBI:53000)
α-L-Fucp-(1→2)-β-D-Galp-(1→4)-β-D-GlcpNAc-yl group (CHEBI:88100) has role epitope (CHEBI:53000)
α-L-Fucp-(1→2)-β-D-Galp-(1→4)-D-Glcp6S (CHEBI:67161) has role epitope (CHEBI:53000)
α-L-Fucp-(1→2)-β-D-Galp-(1→4)-D-GlcpNAc (CHEBI:62263) has role epitope (CHEBI:53000)
α-L-Fucp-(1→2)-β-D-Galp-(1→4)-D-GlcpNAc6S (CHEBI:67162) has role epitope (CHEBI:53000)
α-L-Fucp-(1→2)-β-D-Galp-(1→4)-[α-L-Fucp-(1→3)]-β-D-GlcpNAc (CHEBI:59045) has role epitope (CHEBI:53000)
α-L-Fucp-(1→2)-β-D-Galp-(1→4)-[α-L-Fucp-(1→3)]-β-D-GlcpNAc-yl group (CHEBI:88162) has role epitope (CHEBI:53000)
α-L-Fucp-(1→2)-β-D-Galp6S-(1→4)-D-Glcp (CHEBI:65195) has role epitope (CHEBI:53000)
α-L-Fucp-(1→2)-β-D-Galp6S-(1→4)-D-Glcp6S (CHEBI:65197) has role epitope (CHEBI:53000)
α-L-Fucp-(1→2)-β-D-Galp6S-(1→4)-D-GlcpNAc (CHEBI:65198) has role epitope (CHEBI:53000)
α-L-Fucp-(1→2)-(1→3)-[α-D-Galp]-β-D-Galp-yl group (CHEBI:142573) has role epitope (CHEBI:53000)
α-L-Fucp-(1→2)-[α-D-Galp-(1→3)]-β-D-Galp-(1→3)-α-D-GalpNAc-yl group (CHEBI:88132) has role epitope (CHEBI:53000)
α-L-Fucp-(1→2)-[α-D-Galp-(1→3)]-β-D-Galp-(1→3)-β-D-Galp-yl group (CHEBI:139279) has role epitope (CHEBI:53000)
α-L-Fucp-(1→2)-[α-D-Galp-(1→3)]-β-D-Galp-(1→3)-β-D-GalpNAc-yl group (CHEBI:88134) has role epitope (CHEBI:53000)
α-L-Fucp-(1→2)-[α-D-Galp-(1→3)]-β-D-Galp-(1→3)-β-D-GlcpNAc-yl group (CHEBI:88114) has role epitope (CHEBI:53000)
α-L-Fucp-(1→2)-[α-D-Galp-(1→3)]-β-D-Galp-(1→4)-β-D-Glcp-yl group (CHEBI:139280) has role epitope (CHEBI:53000)
α-L-Fucp-(1→2)-[α-D-Galp-(1→3)]-β-D-Galp-(1→4)-β-D-GlcpNAc-yl group (CHEBI:88124) has role epitope (CHEBI:53000)
α-L-Fucp-(1→2)-[α-D-GalpNAc-(1→3)]-β-D-Galp-(1→3)-α-D-GalpNAc-yl group (CHEBI:88111) has role epitope (CHEBI:53000)
α-L-Fucp-(1→2)-[α-D-GalpNAc-(1→3)]-β-D-Galp-(1→3)-β-D-Galp-yl group (CHEBI:139275) has role epitope (CHEBI:53000)
α-L-Fucp-(1→2)-[α-D-GalpNAc-(1→3)]-β-D-Galp-(1→3)-β-D-GalpNAc-yl group (CHEBI:88113) has role epitope (CHEBI:53000)
α-L-Fucp-(1→2)-[α-D-GalpNAc-(1→3)]-β-D-Galp-(1→3)-β-D-GlcpNAc-yl group (CHEBI:88106) has role epitope (CHEBI:53000)
α-L-Fucp-(1→2)-[α-D-GalpNAc-(1→3)]-β-D-Galp-(1→4)-β-D-Glcp-yl group (CHEBI:139276) has role epitope (CHEBI:53000)
α-L-Fucp-(1→2)-[α-D-GalpNAc-(1→3)]-β-D-Galp-(1→4)-β-D-GlcpNAc-yl group (CHEBI:88110) has role epitope (CHEBI:53000)
α-L-Fucp-(1→2)-[α-D-GalpNAc-(1→3)]-β-D-Galp-(1→4)-[α-L-Fucp-(1→3)]-β-D-GlcpNAc (CHEBI:62990) has role epitope (CHEBI:53000)
α-L-Fucp-(1→2)-[β-D-Galp-(1→3)-α-D-GalpNAc-(1→3)]-β-D-Galp-(1→4)-D-Glcp (CHEBI:68673) has role epitope (CHEBI:53000)
α-L-Fucp-(1→2)-[β-D-Galp-(1→3)-α-D-GalpNAc-(1→3)]-β-D-Galp-(1→4)-D-GlcpNAc (CHEBI:68674) has role epitope (CHEBI:53000)
α-L-Fucp-(1→3)-β-D-GalpNAc-(1→4)-β-D-GlcpNAc-(1→3)-α-D-Galp (CHEBI:61175) has role epitope (CHEBI:53000)
α-L-Fucp-(1→3)-β-D-GalpNAc-(1→4)-D-GlcpNAc (CHEBI:67102) has role epitope (CHEBI:53000)
α-L-Fucp-(1→3)-β-D-GalpNAc-(1→4)-[α-L-Fucp-(1→3)]-β-D-GlcpNAc-(1→3)-α-D-Galp (CHEBI:61173) has role epitope (CHEBI:53000)
α-L-Fucp-(1→3)-β-D-GalpNAc-(1→4)-[α-L-Fucp-(1→3)]-D-GlcpNAc (CHEBI:67094) has role epitope (CHEBI:53000)
α-L-Fucp-(1→3)-[α-Neup5Ac-(2→3)-β-D-Galp6S-(1→4)]-β-D-GlcpNAc (CHEBI:71558) has role epitope (CHEBI:53000)
α-L-Fucp-(1→3)-[β-D-Galp-(1→4)]-β-D-GlcpNAc (CHEBI:59294) has role epitope (CHEBI:53000)
α-L-Fucp-(1→3)-[β-D-Galp-(1→4)]-β-D-GlcpNAc-yl group (CHEBI:88161) has role epitope (CHEBI:53000)
α-L-Fucp-(1→3)-[β-D-Galp-(1→4)]-D-GlcpNAc (CHEBI:62287) has role epitope (CHEBI:53000)
α-L-Fucp-(1→4)-[β-D-Galp3S-(1→3)]-β-D-GlcpNAc (CHEBI:65149) has role epitope (CHEBI:53000)
α-L-FucpNAc-(1→3)-D-FucpNAc (CHEBI:83897) has role epitope (CHEBI:53000)
α-L-fucose (CHEBI:42548) has role epitope (CHEBI:53000)
α-L-fucosyl group (CHEBI:63760) has role epitope (CHEBI:53000)
α-L-fucosyl-(1→2)-β-D-galactosyl group (CHEBI:16124) has role epitope (CHEBI:53000)
α-L-fucosyl-(1→3)-N-acetyl-β-D-glucosamine (CHEBI:62276) has role epitope (CHEBI:53000)
α-L-fucosyl-(1→4)-N-acetyl-β-D-glucosamine (CHEBI:67167) has role epitope (CHEBI:53000)
α-L-Rhap-(1→2)-α-L-Rhap-(1→2)-α-L-Rhap (CHEBI:61763) has role epitope (CHEBI:53000)
α-L-Rhap-(1→2)-α-L-Rhap-(1→3)-α-L-Rhap-(1→3)-β-D-GlcpNAc-(1→2)-α-L-Rhap (CHEBI:59313) has role epitope (CHEBI:53000)
α-L-Rhap-(1→3)-α-D-Galp (CHEBI:61783) has role epitope (CHEBI:53000)
α-L-Rhap-(1→3)-α-D-Galp-(1→2)-[α-D-Abep-(1→3)]-α-D-Manp-(1→4)-α-L-Rhap (CHEBI:59407) has role epitope (CHEBI:53000)
α-L-Rhap-(1→3)-α-L-Rhap-(1→3)-β-D-GlcpNAc (CHEBI:59310) has role epitope (CHEBI:53000)
α-L-rhamnopyranose (CHEBI:27907) has role epitope (CHEBI:53000)
α-KDN-(2→3)-β-D-Galp-(1→3)-α-D-GalpNAc (CHEBI:71434) has role epitope (CHEBI:53000)
α-KDN-(2→3)-β-D-Galp-(1→3)-β-D-GlcpNAc (CHEBI:71438) has role epitope (CHEBI:53000)
α-KDN-(2→3)-β-D-Galp-(1→4)-β-D-GlcpNAc (CHEBI:71442) has role epitope (CHEBI:53000)
α-KDN-(2→3)-β-D-Galp-(1→4)-D-Glcp (CHEBI:71441) has role epitope (CHEBI:53000)
α-KDN-(2→3)-β-D-Galp-(1→4)-[α-L-Fucp-(1→3)]-D-GlcpNAc (CHEBI:71440) has role epitope (CHEBI:53000)
α-KDN-(2→6)-β-D-Galp-(1→4)-D-GlcpNAc (CHEBI:71444) has role epitope (CHEBI:53000)
α-Kdo-(2→8)-[α-Kdo-(2→4)]-α-Kdo (CHEBI:60393) has role epitope (CHEBI:53000)
α-mycolic acid (CHEBI:59235) has role epitope (CHEBI:53000)
α-Neu5Ac-(2→3)-β-D-Gal-(1→3)-[α-L-Fuc-(1→4)]-β-D-GlcNAc (CHEBI:62681) has role epitope (CHEBI:53000)
α-Neu5Ac-(2→3)-β-D-Gal-(1→3)-[α-Neu5Ac-(2→3)-β-D-Gal-(1→4)-[α-L-Fuc-(1→3)]-β-D-GlcNAc-(1→6)]-D-GalNAc (CHEBI:65192) has role epitope (CHEBI:53000)
α-Neu5Ac-(2→3)-β-D-Gal-(1→4)-β-D-GlcNAc-(1→2)-α-D-Man-(1→3)-[α-Neu5Ac-(2→3)-β-D-Gal-(1→4)-β-D-GlcNAc-(1→2)-α-D-Man-(1→6)]-β-D-Man-(1→4)-β-D-GlcNAc-(1→4)-β-D-GlcNAc (CHEBI:71643) has role epitope (CHEBI:53000)
α-Neu5Ac-(2→3)-β-D-Gal-(1→4)-β-D-GlcNAc-(1→2)-α-D-Man-(1→3)-[α-Neu5Ac-(2→6)-β-D-Gal-(1→4)-β-D-GlcNAc-(1→2)-α-D-Man-(1→6)]-β-D-Man-(1→4)-β-D-GlcNAc-(1→4)-β-D-GlcNAc (CHEBI:71646) has role epitope (CHEBI:53000)
α-Neu5Ac-(2→3)-D-Gal (CHEBI:61596) has role epitope (CHEBI:53000)
α-Neu9,NAc2-(2→6)-GalNAc (CHEBI:59571) has role epitope (CHEBI:53000)
α-Neup5,9Ac2-(2→3)-β-D-Galp-(1→4)-β-D-GlcpNAc (CHEBI:72472) has role epitope (CHEBI:53000)
α-Neup5,9Ac2-(2→6)-β-D-Galp-(1→3)-β-D-GlcpNAc (CHEBI:72471) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→3)-α-D-GalpNAc (CHEBI:71564) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→3)-β-D-Galp-(1→3)-α-D-GalpNAc (CHEBI:65257) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→3)-β-D-Galp-(1→3)-α-D-GalpNAc6S (CHEBI:71603) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→3)-β-D-Galp-(1→3)-β-D-GalpNAc-(1→3)-α-D-Galp-(1→4)-β-D-Galp-(1→4)-β-D-Glcp (CHEBI:62313) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→3)-β-D-Galp-(1→3)-β-D-GlcpNAc (CHEBI:71604) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→3)-β-D-Galp-(1→3)-β-D-GlcpNAc-(1→3)-β-D-Galp-(1→3)-β-D-GlcpNAc (CHEBI:71605) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→3)-β-D-Galp-(1→3)-β-D-GlcpNAc-(1→3)-β-D-Galp-(1→4)-β-D-GlcpNAc (CHEBI:72591) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→3)-β-D-Galp-(1→3)-D-GalpNAc (CHEBI:61579) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→3)-β-D-Galp-(1→3)-[α-L-Fucp-(1→4)]-β-D-GlcpNAc-(1→3)-β-D-Galp-(1→3)-[α-L-Fucp-(1→4)]-β-D-GlcpNAc (CHEBI:72592) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→3)-β-D-Galp-(1→3)-[α-L-Fucp-(1→4)]-β-D-GlcpNAc-(1→3)-β-D-Galp-(1→4)-[α-L-Fucp-(1→3)]-β-D-GlcpNAc (CHEBI:72594) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→3)-β-D-Galp-(1→3)-[α-Neup5Ac-(2→3)-β-D-Galp-(1→4)]-β-D-GlcpNAc (CHEBI:71594) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→3)-β-D-Galp-(1→3)-GlcpNAc6S (CHEBI:71585) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→3)-β-D-Galp-(1→4)-β-D-GlcpNAc (CHEBI:71612) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→3)-β-D-Galp-(1→4)-β-D-GlcpNAc-(1→2)-α-D-Manp-(1→6)-[α-Neup5Ac-(2→6)-β-D-Galp-(1→4)-β-D-GlcpNAc-(1→2)-α-D-Manp-(1→3)]-β-D-Manp-(1→4)-β-D-GlcpNAc-(1→4)-β-D-GlcpNAc (CHEBI:72002) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→3)-β-D-Galp-(1→4)-β-D-GlcpNAc-(1→3)-β-D-Galp-(1→3)-β-D-GlcpNAc (CHEBI:71650) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→3)-β-D-Galp-(1→4)-β-D-GlcpNAc-(1→3)-β-D-Galp-(1→4)-β-D-GlcpNAc (CHEBI:71651) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→3)-β-D-Galp-(1→4)-β-D-GlcpNAc-(1→3)-β-D-Galp-(1→4)-β-D-GlcpNAc-(1→3)-β-D-Galp-(1→4)-β-D-GlcpNAc (CHEBI:71664) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→3)-β-D-Galp-(1→4)-β-D-GlcpNAc-(1→3)-β-D-Galp-(1→4)-[α-L-Fucp-(1→3)]-D-GlcpNAc (CHEBI:71660) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→3)-β-D-Galp-(1→4)-β-D-GlcpNAc-(1→3)-β-D-GalpNAc (CHEBI:72545) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→3)-β-D-Galp-(1→4)-β-D-GlcpNAc6S (CHEBI:71617) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→3)-β-D-Galp-(1→4)-[α-L-Fucp-(1→3)]-β-D-GlcpNAc (CHEBI:71622) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→3)-β-D-Galp-(1→4)-[α-L-Fucp-(1→3)]-β-D-GlcpNAc-(1→3)-β-D-Galp (CHEBI:71640) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→3)-β-D-Galp-(1→4)-[α-L-Fucp-(1→3)]-β-D-GlcpNAc-(1→3)-β-D-Galp-(1→4)-β-D-GlcpNAc (CHEBI:71641) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→3)-β-D-Galp-(1→4)-[α-L-Fucp-(1→3)]-β-D-GlcpNAc-(1→3)-β-D-Galp-(1→4)-[α-L-Fucp-(1→3)]-β-D-GlcpNAc-(1→3)-β-D-Galp-(1→4)-[α-L-Fucp-(1→3)]-β-D-GlcpNAc (CHEBI:71642) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→3)-β-D-Galp-(1→4)-[α-L-Fucp-(1→3)]-β-D-GlcpNAc-(1→3)-D-Galp-yl group (CHEBI:142574) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→3)-β-D-Galp-(1→4)-[α-L-Fucp-(1→3)]-β-D-GlcpNAc6S (CHEBI:71628) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→3)-β-D-Galp-(1→4)-[α-L-Fucp-(1→3)]-D-GlcpNAc (CHEBI:61711) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→3)-β-D-Galp-(1→4)-[α-Neup5Ac-(2→3)-β-D-Galp-(1→4)-[β-D-Galp-(1→4)-β-D-Glcp-(1→6)]-β-D-GlcpNAc-(1→3)-β-D-Galp-(1→4)-β-D-Glcp-(1→6)]-2,5-anhydro-D-Man (CHEBI:137226) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→3)-β-D-Galp6S-(1→4)-β-D-GlcpNAc (CHEBI:72543) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→3)-[α-Neup5Ac-(2→6)]-α-D-GalpNAc (CHEBI:71562) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→6)-β-D-Galp (CHEBI:71696) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→6)-β-D-Galp-(1→4)-β-D-Glcp (CHEBI:71943) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→6)-β-D-Galp-(1→4)-β-D-GlcpNAc-(1→2)-α-D-Manp-(1→3)-β-D-Manp-(1→4)-β-D-GlcpNAc-(1→4)-D-GlcpNAc (CHEBI:71990) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→6)-β-D-Galp-(1→4)-β-D-GlcpNAc-(1→2)-α-D-Manp-(1→3)-[α-D-Manp-(1→6)]-β-D-Manp-(1→4)-β-D-GlcpNAc-(1→4)-D-GlcpNAc (CHEBI:71994) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→6)-β-D-Galp-(1→4)-β-D-GlcpNAc-(1→2)-α-D-Manp-(1→3)-[α-Neup5Ac-(2→6)-β-D-Galp-(1→4)-β-D-GlcpNAc-(1→2)-α-D-Manp-(1→6)]-β-D-Manp-(1→4)-β-D-GlcpNAc-(1→4)-β-D-GlcpNAc (CHEBI:72005) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→6)-β-D-Galp-(1→4)-β-D-GlcpNAc-(1→2)-α-D-Manp-(1→3)-[β-D-Galp-(1→4)-β-D-GlcpNAc-(1→2)-α-D-Manp-(1→6)]-β-D-Manp-(1→4)-β-D-GlcpNAc-(1→4)-β-D-GlcpNAc (CHEBI:71999) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→6)-β-D-Galp-(1→4)-β-D-GlcpNAc-(1→2)-α-D-Manp-(1→3)-[β-D-GlcpNAc-(1→2)-α-D-Manp-(1→6)]-β-D-Manp-(1→4)-β-D-GlcpNAc-(1→4)-β-D-GlcpNAc (CHEBI:71995) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→6)-β-D-Galp-(1→4)-β-D-GlcpNAc-(1→2)-α-D-Manp-(1→6)-β-D-Manp-(1→4)-β-D-GlcpNAc-(1→4)-D-GlcpNAc (CHEBI:71991) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→6)-β-D-Galp-(1→4)-β-D-GlcpNAc-(1→3)-β-D-Galp-(1→3)-β-D-GlcpNAc (CHEBI:72617) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→6)-β-D-Galp-(1→4)-β-D-GlcpNAc-(1→3)-β-D-Galp-(1→4)-β-D-GlcpNAc (CHEBI:72007) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→6)-β-D-Galp-(1→4)-β-D-GlcpNAc-(1→3)-β-D-Galp-(1→4)-β-D-GlcpNAc-(1→3)-β-D-Galp-(1→4)-β-D-GlcpNAc (CHEBI:72619) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→6)-β-D-Galp-(1→4)-β-D-GlcpNAc-(1→3)-β-D-Galp-(1→4)-[α-L-Fucp-(1→3)]-β-D-GlcpNAc-(1→3)-β-D-Galp-(1→4)-[α-L-Fucp-(1→3)]-β-D-GlcpNAc (CHEBI:72008) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→6)-β-D-Galp-(1→4)-β-D-GlcpNAc-(1→3)-β-D-GalpNAc (CHEBI:72599) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→6)-β-D-GalpNAc-(1→4)-β-D-GlcpNAc (CHEBI:71669) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→6)-β-D-GlcpNAc-(1→4)-β-D-GlcpNAc-(1→4)-D-GlcpNAc (CHEBI:72318) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→6)-β-D-GlcpNAc-(1→4)-D-GlcpNAc (CHEBI:72009) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→6)-[α-Neup5Ac-(2→3)-β-D-Galp-(1→3)]-α-D-GalpNAc (CHEBI:71602) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→6)-[α-Neup5Ac-(2→3)-β-D-Galp-(1→3)]-D-GalpNAc (CHEBI:71600) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→8)-α-Neup5Ac (CHEBI:62097) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→8)-α-Neup5Ac-(2→3)-β-D-Galp-(1→4)-β-D-Glcp-yl group (CHEBI:142532) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→8)-α-Neup5Ac-(2→8)-α-Neup5Ac (CHEBI:72328) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→8)-α-Neup5Ac-(2→8)-α-Neup5Ac-(2→3)-β-D-Galp-(1→4)-β-D-Glcp (CHEBI:72444) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→8)-α-Neup5Ac-(2→8)-α-Neup5Ac-(2→8)-α-Neup5Ac-(2→3)-[β-D-GalpNAc-(1→4)]-β-D-Galp-(1→4)-β-D-Glcp (CHEBI:72621) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→8)-α-Neup5Ac-(2→8)-α-Neup5Ac-yl group (CHEBI:133887) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→8)-α-Neup5Ac-(2→8)-β-Neup5Ac (CHEBI:65105) has role epitope (CHEBI:53000)
α-Neup5Ac-(2→8)-β-Neup5Ac (CHEBI:65099) has role epitope (CHEBI:53000)
α-Neup5Gc-(2→3)-β-D-Galp-(1→3)-β-D-GlcNAcp (CHEBI:72463) has role epitope (CHEBI:53000)
α-Neup5Gc-(2→3)-β-D-Galp-(1→3)-[α-L-Fucp-(1→4)]-β-D-GlcNAcp (CHEBI:72464) has role epitope (CHEBI:53000)
α-Neup5Gc-(2→3)-β-D-Galp-(1→4)-β-D-Glcp (CHEBI:72467) has role epitope (CHEBI:53000)
α-Neup5Gc-(2→3)-β-D-Galp-(1→4)-β-D-GlcNAcp (CHEBI:72466) has role epitope (CHEBI:53000)
α-Neup5Gc-(2→3)-β-D-Galp-(1→4)-D-Glcp-yl group (CHEBI:138106) has role epitope (CHEBI:53000)
α-Neup5Gc-(2→3)-β-D-Galp-(1→4)-[α-L-Fucp-(1→3)]-β-D-GlcNAcp (CHEBI:72465) has role epitope (CHEBI:53000)
α-Neup5Gc-(2→6)-α-D-GalpNAc (CHEBI:72468) has role epitope (CHEBI:53000)
α-Neup5Gc-(2→6)-β-D-Galp-(1→4)-β-D-GlcpNAc (CHEBI:72469) has role epitope (CHEBI:53000)
α-Neup5Gc-(2→6)-β-D-Galp-(1→4)-D-Glcp-yl group (CHEBI:138104) has role epitope (CHEBI:53000)
α-NeupNAc-(2→6)-β-D-Galp-(1→4)-β-D-GlcpNAc6S (CHEBI:71998) has role epitope (CHEBI:53000)
β-(1→3)-galactobiose (CHEBI:61772) has role epitope (CHEBI:53000)
β-D-Araf-(1→2)-α-D-Araf-(1→3)-α-D-Araf-(1→5)-α-D-Araf-OMe (CHEBI:59944) has role epitope (CHEBI:53000)
β-D-Araf-(1→2)-α-D-Araf-(1→3)-[β-D-Araf-(1→2)-α-D-Araf-(1→5)]-α-D-Araf-(1→5)-α-D-Araf (CHEBI:78885) has role epitope (CHEBI:53000)
β-D-Araf-(1→2)-α-D-Araf-(1→5)-α-D-Araf-(1→5)-α-D-Araf (CHEBI:60730) has role epitope (CHEBI:53000)
β-D-Araf-(1→2)-α-D-Araf-(1→5)-α-D-Araf-(1→5)-α-D-Araf-OMe (CHEBI:59943) has role epitope (CHEBI:53000)
β-D-Araf-(1→2)-α-D-Araf-(1→5)-[β-D-Araf-(1→2)-α-D-Araf-(1→3)]-α-D-Araf-(1→5)-α-D-Araf-OMe (CHEBI:59942) has role epitope (CHEBI:53000)
β-D-Araf-(1→2)-α-D-Araf-(1→5)-[β-D-Araf-(1→2)-α-D-Araf-(1→3)]-α-D-Araf-(1→5)-α-D-Araf-yl group (CHEBI:59592) has role epitope (CHEBI:53000)
β-D-Gal-(1→3)-β-D-GalNAc-(1→4)-β-D-Gal-(1→4)-β-D-Glc-yl group (CHEBI:142508) has role epitope (CHEBI:53000)
β-D-Gal-(1→3)-[α-L-Fuc-(1→4)]-β-D-GlcNAc-(1→2)-α-DMan-(1→3)-{β-D-Gal-(1→3)-[α-L-Fuc-(1→4)]-β-D-GlcNAc-(1→2)-α-DMan-(1→6)}-β-D-Man-(1→4)-β-D-GlcNAc-(1→4)-β-D-GlcNAc (CHEBI:68559) has role epitope (CHEBI:53000)
β-D-Gal-(1→3)-[α-L-Fuc-(1→4)]-β-D-GlcNAc-(1→2)-α-DMan-(1→3)-{β-D-Gal-(1→3)-[α-L-Fuc-(1→4)]-β-D-GlcNAc-(1→2)-α-DMan-(1→6)}-β-D-Man-(1→4)-β-D-GlcNAc-(1→4)-[α-L-Fuc-(1→6)]-β-D-GlcNAc (CHEBI:68544) has role epitope (CHEBI:53000)
β-D-Gal-(1→3)-[β-D-GlcNAc-(1→6)]-D-GalNAc (CHEBI:61581) has role epitope (CHEBI:53000)
β-D-Gal-(1→4)-α-D-Glc-(1→3)-[α-D-GlcNAc-(1→2)]-α-L-Hep (CHEBI:59861) has role epitope (CHEBI:53000)
β-D-Gal-(1→4)-β-D-GlcNAc-(1→2)-[β-D-Gal-(1→4)-β-D-GlcNAc-(1→4)]-α-D-Man-(1→3)-[β-D-Gal-(1→4)-β-D-GlcNAc-(1→2)-α-D-Man-(1→6)]-β-D-Man-(1→4)-β-D-GlcNAc-(1→4)-β-D-GlcNAc (CHEBI:70853) has role epitope (CHEBI:53000)
β-D-Galf-(1→3)-α-D-Manp (CHEBI:61742) has role epitope (CHEBI:53000)
β-D-Galp-(1→2)-β-D-Galp (CHEBI:68541) has role epitope (CHEBI:53000)
β-D-Galp-(1→2)-L-glycero-α-D-manno-Hepp-(1→2)-L-glycero-α-D-manno-Hepp-(1→3)-L-glycero-α-D-manno-Hepp-(1→5)-Kdo (CHEBI:59518) has role epitope (CHEBI:53000)
β-D-Galp-(1→3)-β-D-Galp-(1→3)-β-D-Galp-(1→3)-β-D-Galp6P-(1→4)-α-D-Manp (CHEBI:59619) has role epitope (CHEBI:53000)
β-D-Galp-(1→3)-β-D-Galp-(1→4)-β-D-GlcpNAc (CHEBI:68680) has role epitope (CHEBI:53000)
β-D-Galp-(1→3)-β-D-Galp6P-(1→4)-α-D-Manp (CHEBI:59615) has role epitope (CHEBI:53000)
β-D-Galp-(1→3)-β-D-GalpNAc (CHEBI:61243) has role epitope (CHEBI:53000)
β-D-Galp-(1→3)-β-D-GalpNAc-(1→3)-α-D-Galp-(1→4)-β-D-Galp-(1→4)-β-D-Glcp (CHEBI:62311) has role epitope (CHEBI:53000)
β-D-Galp-(1→3)-β-D-GalpNAc-(1→3)-α-D-Galp-(1→4)-β-D-Galp-(1→4)-D-Glcp (CHEBI:141842) has role epitope (CHEBI:53000)
β-D-Galp-(1→3)-β-D-GalpNAc-(1→3)-α-D-Galp-(1→4)-β-D-Galp-yl group (CHEBI:142568) has role epitope (CHEBI:53000)
β-D-Galp-(1→3)-β-D-GalpNAc-(1→4)-[α-Neup5Ac-(2→3)]-β-D-Galp-(1→4)-β-D-Glcp (CHEBI:59208) has role epitope (CHEBI:53000)
β-D-Galp-(1→3)-β-D-GalpNAc-(1→4)-[α-Neup5Ac-(2→3)]-D-Galp-yl group (CHEBI:90981) has role epitope (CHEBI:53000)
β-D-Galp-(1→3)-β-D-GlcpNAc (CHEBI:61246) has role epitope (CHEBI:53000)
β-D-Galp-(1→3)-β-D-GlcpNAc-(1→2)-α-D-Manp-(1→3)-[β-D-Galp-(1→3)-β-D-GlcpNAc-(1→2)-α-D-Manp-(1→6)]-β-D-Manp-(1→4)-β-D-GlcpNAc-(1→4)-β-D-GlcpNAc (CHEBI:68816) has role epitope (CHEBI:53000)
β-D-Galp-(1→3)-β-D-GlcpNAc-(1→2)-α-D-Manp-(1→3)-[β-D-Galp-(1→3)-β-D-GlcpNAc-(1→2)-α-D-Manp-(1→6)]-β-D-Manp-(1→4)-β-D-GlcpNAc-(1→4)-[α-L-Fucp-(1→6)]-β-D-GlcpNAc (CHEBI:68690) has role epitope (CHEBI:53000)
β-D-Galp-(1→3)-β-D-GlcpNAc-(1→3)-β-D-Galp-(1→3)-β-D-GlcpNAc (CHEBI:68842) has role epitope (CHEBI:53000)
β-D-Galp-(1→3)-β-D-GlcpNAc-(1→3)-β-D-Galp-(1→4)-β-D-GlcpNAc (CHEBI:68843) has role epitope (CHEBI:53000)
β-D-Galp-(1→3)-β-D-GlcpNAc-(1→4)-β-D-Galp-(1→4)-β-D-Glcp (CHEBI:59216) has role epitope (CHEBI:53000)
β-D-Galp-(1→3)-D-GalpNAc (CHEBI:546807) has role epitope (CHEBI:53000)
β-D-Galp-(1→3)-D-GlcpNAc (CHEBI:27707) has role epitope (CHEBI:53000)
β-D-Galp-(1→3)-[α-L-Fucp-(1→4)]-β-D-GlcpNAc-(1→3)-β-D-Galp-(1→3)-[α-L-Fucp-(1→4)]-β-D-GlcpNAc (CHEBI:68580) has role epitope (CHEBI:53000)
β-D-Galp-(1→3)-[α-L-Fucp-(1→4)]-β-D-GlcpNAc-(1→3)-β-D-Galp-(1→4)-β-D-GlcpNAc (CHEBI:68585) has role epitope (CHEBI:53000)
β-D-Galp-(1→3)-[α-L-Fucp-(1→4)]-β-D-GlcpNAc-(1→3)-β-D-Galp-(1→4)-[α-L-Fucp-(1→3)]-β-D-GlcpNAc (CHEBI:68582) has role epitope (CHEBI:53000)
β-D-Galp-(1→3)-[α-L-Fucp-(1→4)]-β-D-GlcpNAc-yl group (CHEBI:88151) has role epitope (CHEBI:53000)
β-D-Galp-(1→3)-[α-L-Fucp-(1→4)]-D-GlcpNAc (CHEBI:62265) has role epitope (CHEBI:53000)
β-D-Galp-(1→3)-[α-Neup5Ac-(2→6)]-α-D-GalpNAc (CHEBI:63233) has role epitope (CHEBI:53000)
β-D-Galp-(1→3)-[α-Neup5Ac-(2→6)]-α-D-GlcpNAc-(1→4)-β-D-Galp-(1→4)-β-D-Glcp (CHEBI:68619) has role epitope (CHEBI:53000)
β-D-Galp-(1→3)-[β-D-Galp-(1→4)-β-D-GlcpNAc-(1→6)]-α-D-GalpNAc (CHEBI:62185) has role epitope (CHEBI:53000)
β-D-Galp-(1→3)-[β-D-Galp-(1→4)-β-D-GlcpNAc-(1→6)]-D-GalpNAc (CHEBI:68586) has role epitope (CHEBI:53000)
β-D-Galp-(1→3)-[β-Neup5Ac-(2→6)]-α-D-GalpNAc (CHEBI:67002) has role epitope (CHEBI:53000)
β-D-Galp-(1→3)-{α-Neup5Ac-(2→3)-β-D-Galp-(1→4)-[α-L-Fucp-(1→3)]-β-D-GlcNAc-(1→6)}-D-GalNAc (CHEBI:68608) has role epitope (CHEBI:53000)
β-D-Galp-(1→4)-α-D-GalpNAc-(1→3)-[α-L-Fucp-(1→2)]-β-D-Galp-(1→4)-β-D-GlcpNAc (CHEBI:70841) has role epitope (CHEBI:53000)
β-D-Galp-(1→4)-α-D-GlcpNAc-(1→6)-β-D-Galp-(1→4)-β-D-GlcpNAc (CHEBI:70849) has role epitope (CHEBI:53000)
β-D-Galp-(1→4)-β-D-Glcp6S (CHEBI:70825) has role epitope (CHEBI:53000)
β-D-Galp-(1→4)-β-D-GlcpNAc-(1→2)-α-D-Manp-(1→3)-β-D-Manp-(1→4)-β-D-GlcpNAc-(1→4)-D-GlcpNAc (CHEBI:71039) has role epitope (CHEBI:53000)
β-D-Galp-(1→4)-β-D-GlcpNAc-(1→2)-α-D-Manp-(1→3)-[α-D-Manp-(1→6)]-β-D-Manp-(1→4)-β-D-GlcpNAc-(1→4)-β-D-GlcpNAc (CHEBI:70969) has role epitope (CHEBI:53000)
β-D-Galp-(1→4)-β-D-GlcpNAc-(1→2)-α-D-Manp-(1→3)-[α-Neup5Ac-(2→6)-β-D-Galp-(1→4)-β-D-GlcpNAc-(1→2)-α-D-Manp-(1→6)]-β-D-Manp-(1→4)-β-D-GlcpNAc-(1→4)-β-D-GlcpNAc (CHEBI:71035) has role epitope (CHEBI:53000)
β-D-Galp-(1→4)-β-D-GlcpNAc-(1→2)-α-D-Manp-(1→3)-[β-D-Galp-(1→4)-β-D-GlcpNAc-(1→2)-α-D-Manp-(1→6)]-β-D-Man-(1→4)-β-D-GlcpNAc-(1→4)-[α-L-Fucp-(1→6)]-β-D-GlcpNAc (CHEBI:70967) has role epitope (CHEBI:53000)
β-D-Galp-(1→4)-β-D-GlcpNAc-(1→2)-α-D-Manp-(1→3)-[β-D-Galp-(1→4)-β-D-GlcpNAc-(1→2)-α-D-Manp-(1→6)]-β-D-Manp-(1→4)-β-D-GlcpNAc-(1→4)-β-D-GlcpNAc (CHEBI:70965) has role epitope (CHEBI:53000)
β-D-Galp-(1→4)-β-D-GlcpNAc-(1→2)-α-D-Manp-(1→3)-{α-L-Fucp-(1→3)-[β-D-Galp-(1→4)]-β-D-GlcpNAc-(1→2)-α-D-Manp-(1→6)}-β-D-Man-(1→4)-β-D-GlcpNAc-(1→4)-β-D-GlcpNAc (CHEBI:70962) has role epitope (CHEBI:53000)
β-D-Galp-(1→4)-β-D-GlcpNAc-(1→2)-α-D-Manp-(1→6)-β-D-Manp-(1→4)-β-D-GlcpNAc-(1→4)-D-GlcpNAc (CHEBI:71040) has role epitope (CHEBI:53000)
β-D-Galp-(1→4)-β-D-GlcpNAc-(1→2)-α-D-Manp-(1→6)-[α-D-Manp-(1→3)]-β-D-Manp-(1→4)-β-D-GlcpNAc-(1→4)-β-D-GlcpNAc (CHEBI:71485) has role epitope (CHEBI:53000)
β-D-Galp-(1→4)-β-D-GlcpNAc-(1→3)-β-D-Galp-(1→3)-β-D-GlcpNAc (CHEBI:71055) has role epitope (CHEBI:53000)
β-D-Galp-(1→4)-β-D-GlcpNAc-(1→3)-β-D-Galp-(1→4)-β-D-GlcpNAc (CHEBI:71203) has role epitope (CHEBI:53000)
β-D-Galp-(1→4)-β-D-GlcpNAc-(1→3)-β-D-Galp-(1→4)-β-D-GlcpNAc-(1→3)-β-D-Galp-(1→4)-β-D-GlcpNAc (CHEBI:71205) has role epitope (CHEBI:53000)
β-D-Galp-(1→4)-β-D-GlcpNAc-(1→3)-β-D-Galp-(1→4)-[α-L-Fucp-(1→3)]-β-D-GlcpNAc-(1→3)-β-D-Galp-(1→4)-[α-L-Fucp-(1→3)]-β-D-GlcpNAc (CHEBI:71058) has role epitope (CHEBI:53000)
β-D-Galp-(1→4)-β-D-GlcpNAc-(1→3)-D-GalpNAc (CHEBI:71053) has role epitope (CHEBI:53000)
β-D-Galp-(1→4)-β-D-GlcpNAc-(1→3)-[β-D-Galp-(1→4)-β-D-GlcpNAc-(1→6)]-α-D-GalpNAc (CHEBI:65123) has role epitope (CHEBI:53000)
β-D-Galp-(1→4)-β-D-GlcpNAc-(1→3)-[β-D-Galp-(1→4)-β-D-GlcpNAc-(1→6)]-β-D-Galp-(1→4)-D-GlcpNAc (CHEBI:71042) has role epitope (CHEBI:53000)
β-D-Galp-(1→4)-β-D-GlcpNAc-(1→3)-[β-D-GlcpNAc-(1→6)]-β-D-Galp-(1→4)-D-GlcpNAc (CHEBI:71051) has role epitope (CHEBI:53000)
β-D-Galp-(1→4)-β-D-GlcpNAc-(1→6)-α-D-GalpNAc (CHEBI:71206) has role epitope (CHEBI:53000)
β-D-Galp-(1→4)-β-D-GlcpNAc-(1→6)-β-D-Galp-(1→4)-β-D-GlcpNAc (CHEBI:71208) has role epitope (CHEBI:53000)
β-D-Galp-(1→4)-β-D-GlcNAcp-(1→3)-β-D-Galp-(1→4)-β-D-Glcp (CHEBI:61844) has role epitope (CHEBI:53000)
β-D-Galp-(1→4)-[α-L-Fucp-(1→3)]-β-D-GlcpNAc-(1→3)-β-D-Galp-(1→3)-[α-L-Fucp-(1→4)]-β-D-GlcpNAc (CHEBI:70753) has role epitope (CHEBI:53000)
β-D-Galp-(1→4)-[α-L-Fucp-(1→3)]-β-D-GlcpNAc-(1→3)-β-D-Galp-(1→4)-[α-L-Fucp-(1→3)]-β-D-GlcpNAc-(1→3)-β-D-Galp-(1→4)-[α-L-Fucp-(1→3)]-β-D-GlcpNAc (CHEBI:61169) has role epitope (CHEBI:53000)
β-D-Galp-(1→4)-[α-L-Fucp-(1→3)]-β-D-GlcpNAc-(1→4)-β-D-Galp-(1→4)-[α-L-Fucp-(1→3)]-β-D-GlcpNAc (CHEBI:70754) has role epitope (CHEBI:53000)
β-D-Galp-(1→4)-[α-L-Fucp-(1→3)]-β-D-GlcpNAc-(1→4)-β-D-Galp-(1→4)-[α-L-Fucp-(1→3)]-β-D-GlcpNAc-(1→4)-β-D-Galp-(1→4)-[α-L-Fucp-(1→3)]-β-D-GlcpNAc (CHEBI:70759) has role epitope (CHEBI:53000)
β-D-Galp-(1→4)-[α-L-Fucp-(1→3)]-β-D-GlcpNAc-(1→6)-[β-D-Galp-(1→3)]-β-D-GalpNAc-(1→3)-α-D-Galp-(1→4)-β-D-Galp-(1→4)-D-Glcp (CHEBI:141846) has role epitope (CHEBI:53000)
β-D-Galp-(1→4)-[α-L-Fucp-(1→3)]-D-Glcp6S (CHEBI:70832) has role epitope (CHEBI:53000)
β-D-Galp3S-(1→3-)-α-D-GalpNAc (CHEBI:65150) has role epitope (CHEBI:53000)
β-D-Galp3S-(1→3-)-β-D-GlcpNAc (CHEBI:65151) has role epitope (CHEBI:53000)
β-D-Galp3S-(1→4)-β-D-Glcp (CHEBI:65179) has role epitope (CHEBI:53000)
β-D-Galp3S-(1→4)-β-D-Glcp6S (CHEBI:65152) has role epitope (CHEBI:53000)
β-D-Galp3S-(1→4)-β-D-GlcpNAc (CHEBI:65178) has role epitope (CHEBI:53000)
β-D-Galp3S-(1→4)-β-D-GlcpNAc6S (CHEBI:65174) has role epitope (CHEBI:53000)
β-D-Galp3S-(1→4)-[α-L-Fucp-(1→3)]-β-D-GlcpNAc (CHEBI:65171) has role epitope (CHEBI:53000)
β-D-Galp3S-(1→4)-[α-L-Fucp-(1→3)]-D-Glcp (CHEBI:65170) has role epitope (CHEBI:53000)
β-D-Galp3S-(1→4)-[α-L-Fucp-(1→3)]-D-Glcp6S (CHEBI:65153) has role epitope (CHEBI:53000)
β-D-Galp3S-(1→4)-[α-L-Fucp-(1→3)]-D-GlcpNAc (CHEBI:65176) has role epitope (CHEBI:53000)
β-D-Galp3S-(1→4)-[α-L-Fucp-(1→3)]-D-GlcpNAc6S (CHEBI:65175) has role epitope (CHEBI:53000)
β-D-Galp4S-(1→4)-β-D-GlcpNAc (CHEBI:65182) has role epitope (CHEBI:53000)
β-D-Galp6P-(1→4)-α-D-Manp (CHEBI:59614) has role epitope (CHEBI:53000)
β-D-Galp6S-(1→4)-β-D-GlcpNAc (CHEBI:65185) has role epitope (CHEBI:53000)
β-D-Galp6S-(1→4)-β-D-Glcp (CHEBI:65186) has role epitope (CHEBI:53000)
β-D-Galp6S-(1→4)-β-D-Glcp6S (CHEBI:65184) has role epitope (CHEBI:53000)
β-D-Galp6S-(1→4)-β-D-GlcpNAc6S (CHEBI:65183) has role epitope (CHEBI:53000)
β-D-GalpNAc-(1→3)-α-D-Galp-(1→4)-β-D-Galp-(1→4)-β-D-GlcpNAc (CHEBI:68442) has role epitope (CHEBI:53000)
β-D-GalpNAc-(1→3)-α-D-GalpNAc (CHEBI:68439) has role epitope (CHEBI:53000)
β-D-GalpNAc-(1→3)-[α-L-Fucp-(1→2)]-β-D-Galp (CHEBI:68436) has role epitope (CHEBI:53000)
β-D-GalpNAc-(1→4)-α-D-GalpNAc (CHEBI:59357) has role epitope (CHEBI:53000)
β-D-GalpNAc-(1→4)-β-D-GlcpNAc (CHEBI:68448) has role epitope (CHEBI:53000)
β-D-GalpNAc-(1→4)-β-D-GlcpNAc-(1→2)-α-D-Manp-(1→3)-[β-D-GalpNAc-(1→4)-β-D-GlcpNAc-(1→2)-α-D-Manp-(1→6)]-β-D-Manp-(1→4)-β-D-GlcpNAc-(1→4)-D-GlcpNAc (CHEBI:68450) has role epitope (CHEBI:53000)
β-D-GalpNAc-(1→4)-β-D-GlcpNAc-(1→3)-α-D-Galp (CHEBI:61187) has role epitope (CHEBI:53000)
β-D-GalpNAc-(1→4)-D-GlcpNAc (CHEBI:61190) has role epitope (CHEBI:53000)
β-D-GalpNAc-(1→4)-[α-L-Fucp-(1→2)-α-L-Fucp-(1→3)]-β-D-GlcpNAc (CHEBI:61171) has role epitope (CHEBI:53000)
β-D-GalpNAc-(1→4)-[α-L-Fucp-(1→2)-α-L-Fucp-(1→3)]-D-GlcpNAc (CHEBI:61189) has role epitope (CHEBI:53000)
β-D-GalpNAc-(1→4)-[α-L-Fucp-(1→3)]-β-D-GlcpNAc (CHEBI:68446) has role epitope (CHEBI:53000)
β-D-GalpNAc-(1→4)-[α-L-Fucp-(1→3)]-β-D-GlcpNAc-(1→3)-α-D-Galp (CHEBI:61179) has role epitope (CHEBI:53000)
β-D-GalpNAc-(1→4)-[α-L-Fucp-(1→3)]-D-GlcpNAc (CHEBI:61864) has role epitope (CHEBI:53000)
β-D-GalpNAc-(1→4)-[α-Neup5Ac-(2→3)]-β-D-Galp-(1→4)-β-D-GlcpNAc (CHEBI:71561) has role epitope (CHEBI:53000)
β-D-GalpNAc-(1→4)-[α-Neup5Ac-(2→3)]-D-Galp (CHEBI:133780) has role epitope (CHEBI:53000)
β-D-GalpNAc-(1→4)-[α-Neup5Gc-(2→3)]-β-D-Galp (CHEBI:133503) has role epitope (CHEBI:53000)
β-D-GalpNAc-(1→4)-[α-Neup5Gc-(2→3)]-β-D-Galp-(1→4)-R group (CHEBI:142521) has role epitope (CHEBI:53000)
β-D-galactose (CHEBI:27667) has role epitope (CHEBI:53000)
β-D-galactosyl-(1→3)-α-D-mannose (CHEBI:60477) has role epitope (CHEBI:53000)
β-D-galactosyl-(1→3)-N-acetyl-α-D-galactosaminyl group (CHEBI:16117) has role epitope (CHEBI:53000)
β-D-galactosyl-(1→3)-N-acetyl-β-D-galactosaminyl group (CHEBI:88150) has role epitope (CHEBI:53000)
β-D-galactosyl-(1→3)-N-acetyl-β-D-glucosaminyl group (CHEBI:88144) has role epitope (CHEBI:53000)
β-D-galactosyl-(1→4)-N-acetyl-β-D-glucosaminyl group (CHEBI:12357) has role epitope (CHEBI:53000)
β-D-GalNAc-(1→4)-β-D-Gal-(1→4)-β-D-Glc-yl group (CHEBI:142518) has role epitope (CHEBI:53000)
β-D-GalNAc-(1→4)-β-D-GalNAc-yl group (CHEBI:142442) has role epitope (CHEBI:53000)
β-D-GalNAc-(1→4)-[α-Neu5Ac-(2→3)]-β-D-Gal-(1→4)-β-D-GalNAc-(1→3)-β-D-Gal-(1→4)-β-D-Glc-(1↔1')-Cer (CHEBI:66972) has role epitope (CHEBI:53000)
β-D-GalNAc-(1→4)-[α-Neu5Ac-(2→8)-α-Neu5Ac-(2→3)]-β-D-Gal-(1→4)-D-Glc (CHEBI:87497) has role epitope (CHEBI:53000)
β-D-Glcp(1→6)-α-D-GlcpNAc-(1→3)-α-L-QuipNAc-(1→3)-β-D-GlcpNAc (CHEBI:59395) has role epitope (CHEBI:53000)
β-D-Glcp-(1→3)-β-D-Glcp-(1→3)-β-D-Glcp-(1→3)-β-D-Glcp-(1→3)-β-D-Glcp-(1→3)-β-D-GlcpO[CH2]5CO2Me (CHEBI:141766) has role epitope (CHEBI:53000)
β-D-Glcp-(1→6)-β-D-Glcp (CHEBI:71422) has role epitope (CHEBI:53000)
β-D-GlcpA-(1→3)-β-D-Galp (CHEBI:71210) has role epitope (CHEBI:53000)
β-D-GlcpA-(1→3)-β-D-GlcpNAc (CHEBI:61029) has role epitope (CHEBI:53000)
β-D-GlcpA-(1→6)-β-D-Galp (CHEBI:71268) has role epitope (CHEBI:53000)
β-D-GlcpNAc-(1→2)-α-D-Manp-(1→3)-[α-Neup5Ac-(2→6)-β-D-Galp-(1→4)-β-D-GlcpNAc-(1→2)-α-D-Manp-(1→6)]-β-D-Manp-(1→4)-β-GlcpNAc-(1→4)-β-D-GlcpNAc (CHEBI:71334) has role epitope (CHEBI:53000)
β-D-GlcpNAc-(1→2)-α-D-Manp-(1→3)-[β-D-GlcpNAc-(1→2)-α-D-Manp-(1→6)]-β-D-Manp-(1→4)-β-GlcpNAc-(1→4)-β-D-GlcpNAc (CHEBI:71325) has role epitope (CHEBI:53000)
β-D-GlcpNAc-(1→2)-α-D-Manp-(1→3)-[β-D-GlcpNAc-(1→2)-α-D-Manp-(1→6)]-β-D-Manp-(1→4)-β-GlcpNAc-(1→4)-[α-L-Fucp-(1→6)]-β-D-GlcpNAc (CHEBI:71327) has role epitope (CHEBI:53000)
β-D-GlcpNAc-(1→2)-β-D-Galp-(1→3)-α-D-GalpNAc (CHEBI:71324) has role epitope (CHEBI:53000)
β-D-GlcpNAc-(1→3)-α-D-GalpNAc (CHEBI:71344) has role epitope (CHEBI:53000)
β-D-GlcpNAc-(1→3)-β-D-Galp (CHEBI:71348) has role epitope (CHEBI:53000)
β-D-GlcpNAc-(1→3)-β-D-Galp-(1→3)-α-D-GalpNAc (CHEBI:71350) has role epitope (CHEBI:53000)
β-D-GlcpNAc-(1→3)-β-D-Galp-(1→4)-β-D-Glcp (CHEBI:61758) has role epitope (CHEBI:53000)
β-D-GlcpNAc-(1→3)-β-D-Galp-(1→4)-β-D-GlcpNAc (CHEBI:71355) has role epitope (CHEBI:53000)
β-D-GlcpNAc-(1→3)-β-D-Galp-(1→4)-β-D-GlcpNAc-(1→3)-β-D-Galp-(1→4)-β-D-GlcpNAc (CHEBI:71357) has role epitope (CHEBI:53000)
β-D-GlcpNAc-(1→3)-D-Manp (CHEBI:71359) has role epitope (CHEBI:53000)
β-D-GlcpNAc-(1→3)-[β-D-GlcpNAc-(1→4)]-[β-D-GlcpNAc-(1→6)]-D-GlcpNAc (CHEBI:71340) has role epitope (CHEBI:53000)
β-D-GlcpNAc-(1→3)-[β-D-GlcpNAc-(1→6)]-α-D-GalpNAc (CHEBI:71341) has role epitope (CHEBI:53000)
β-D-GlcpNAc-(1→3)-[β-D-GlcpNAc-(1→6)]-β-D-Galp-(1→4)-β-D-GlcpNAc (CHEBI:71342) has role epitope (CHEBI:53000)
β-D-GlcpNAc-(1→4)-β-D-Galp-(1→4)-β-D-GlcpNAc (CHEBI:71398) has role epitope (CHEBI:53000)
β-D-GlcpNAc-(1→4)-β-D-GlcpNAc-(1→4)-β-D-GlcpNAc (CHEBI:71404) has role epitope (CHEBI:53000)
β-D-GlcpNAc-(1→4)-β-D-GlcpNAc-(1→4)-β-D-GlcpNAc-(1→4)-β-D-GlcpNAc-(1→4)-β-D-GlcpNAc (CHEBI:65124) has role epitope (CHEBI:53000)
β-D-GlcpNAc-(1→4)-β-D-GlcpNAc-(1→4)-β-D-GlcpNAc-(1→4)-β-D-GlcpNAc-(1→4)-β-D-GlcpNAc-(1→4)-β-D-GlcpNAc (CHEBI:65128) has role epitope (CHEBI:53000)
β-D-GlcpNAc-(1→4)-[α-Neup5Ac-(2→3)]-β-D-Galp-(1→4)-β-D-Glcp (CHEBI:59220) has role epitope (CHEBI:53000)
β-D-GlcpNAc-(1→4)-[β-D-GlcpNAc-(1→6)]-α-D-GalpNAc (CHEBI:71360) has role epitope (CHEBI:53000)
β-D-GlcpNAc-(1→6)-α-D-GalpNAc (CHEBI:71411) has role epitope (CHEBI:53000)
β-D-GlcpNAc-(1→6)-β-D-Galp-(1→4)-β-D-GlcpNAc (CHEBI:71413) has role epitope (CHEBI:53000)
β-D-GlcpNAc6S-(1→3)-β-D-Galp-(1→4)-β-D-GlcpNAc (CHEBI:65120) has role epitope (CHEBI:53000)
β-D-GlcNAc-(1→4)-MDP-Lys(L18) (CHEBI:71405) has role epitope (CHEBI:53000)
β-D-glucose (CHEBI:15903) has role epitope (CHEBI:53000)
β-D-glucose 6-phosphate (CHEBI:17719) has role epitope (CHEBI:53000)
β-D-glucosyl-N-(octadecanoyl)sphinganine (CHEBI:42965) has role epitope (CHEBI:53000)
β-D-Manp-(1→2)-β-D-Manp-(1→2)-α-D-Manp (CHEBI:64170) has role epitope (CHEBI:53000)
β-D-Manp-(1→2)-β-D-Manp-(1→2)-β-D-Manp (CHEBI:78883) has role epitope (CHEBI:53000)
β-D-Manp-(1→2)-β-D-Manp-(1→2)-β-D-Manp-(1→2)-D-Manp (CHEBI:59250) has role epitope (CHEBI:53000)
β-D-mannose (CHEBI:28563) has role epitope (CHEBI:53000)
β-D-QuiN4Fm-(1→4)-α-D-GalNAcAN-(1→4)-α-D-GalNAcAN-(1→3)-β-D-QuiNAc-yl group (CHEBI:76129) has role epitope (CHEBI:53000)
β-D-QuiN4Fm-(1→4)-α-D-GalNAcAN-yl group (CHEBI:76135) has role epitope (CHEBI:53000)
β-D-Tyvp-(1→3)-β-D-GalpN-OMe (CHEBI:77101) has role epitope (CHEBI:53000)
β-D-Tyvp-(1→3)-β-D-GalpN6,OMe2 (CHEBI:77114) has role epitope (CHEBI:53000)
β-D-Tyvp-(1→3)-β-D-GalpNAc-(1→4)-[α-L-Fucp-(1→3)]-β-D-GlcpNAc-OMe (CHEBI:61195) has role epitope (CHEBI:53000)
β-D-Tyvp-(1→3)-β-D-GalpNAc-OMe (CHEBI:77100) has role epitope (CHEBI:53000)
β-D-Tyvp-(1→3)-β-D-GalpNAc6,OMe2 (CHEBI:77104) has role epitope (CHEBI:53000)
β-D-Tyvp2Me-(1→3)-β-D-GalpN6,OMe2 (CHEBI:77116) has role epitope (CHEBI:53000)
β-D-Tyvp2Me-(1→3)-β-D-GalpNAc-OMe (CHEBI:77112) has role epitope (CHEBI:53000)
β-L-fucosyl-(1→3)-N-acetyl-β-D-glucosamine (CHEBI:67166) has role epitope (CHEBI:53000)
β-cellobiose (CHEBI:36217) has role epitope (CHEBI:53000)
β-GalNAc-(1→4)-[α-Neu5Ac-(2→8)-α-Neu5Ac-(2→3)]-β-Gal-(1→4)-R group (CHEBI:142522) has role epitope (CHEBI:53000)
β-melibiose (CHEBI:61827) has role epitope (CHEBI:53000)
β-Neup5Gc-(2→6)-β-D-Galp-(1→4)-D-GlcpNAc (CHEBI:72462) has role epitope (CHEBI:53000)
β-NeupNAc-(2→6)-β-D-Galp-(1→4)-β-D-GlcpNAc (CHEBI:71945) has role epitope (CHEBI:53000)
(2E)-4-hydroxy-3-methylbut-2-en-1-yl diphosphate (CHEBI:15664) has role epitope (CHEBI:53000)
(2E)-4-hydroxy-3-methylbut-2-enyl diphosphate(3−) (CHEBI:128753) has role epitope (CHEBI:53000)
(4S)-2-methylpentane-2,4-diol (CHEBI:44224) has role epitope (CHEBI:53000)
(4Z)-2,8:7,12:11,15:14,18:17,22-pentaanhydro-4,5,6,9,10,13,19,20,21-nonadeoxy-L-arabino-L-allo-L-allo-docosa-4,9,20-trienitol (CHEBI:59526) has role epitope (CHEBI:53000)
(S)-2-(4-nitrobenzyl)-DOTA (CHEBI:42034) has role epitope (CHEBI:53000)
(S)-2-{4-[2-(2-hydroxyethylthio)acetamido]benzyl}-DOTA (CHEBI:42122) has role epitope (CHEBI:53000)
1,2-di-O-[1-14C]-palmitoyl-sn-glycero-3-phosphocholine (CHEBI:60474) has role epitope (CHEBI:53000)
1,2-di-O-palmitoyl-sn-glycero-3-phosphocholine (CHEBI:40265) has role epitope (CHEBI:53000)
1,6:5,9:8,12:11,16-tetraanhydro-2,3,4,10,13,14-hexadeoxy-D-glycero-D-allo-D-gulo-heptadeca-2,13-dienitol (CHEBI:59525) has role epitope (CHEBI:53000)
1,7,8,9,10,10-hexachloro-4-methyl-4-azatricyclo[5.2.1.0(2,6)]dec-8-ene-3,5-dione (CHEBI:47397) has role epitope (CHEBI:53000)
1-(3,6-di-O-sulfo-β-D-galactosyl)-N-lauroylsphingosine (CHEBI:72337) has role epitope (CHEBI:53000)
1-(3-O-sulfo-β-D-galactosyl)-N-[(15Z)-tetracos-15-enoyl]sphingosine (CHEBI:41539) has role epitope (CHEBI:53000)
1-(3-O-sulfo-β-D-galactosyl)-N-stearoylsphingosine (CHEBI:45644) has role epitope (CHEBI:53000)
1-O-(α-D-galactopyranosyl)-N-hexacosanoylsphinganine (CHEBI:63008) has role epitope (CHEBI:53000)
1-O-(α-D-galactopyranosyl)-N-pamitoylphytosphingosine (CHEBI:72334) has role epitope (CHEBI:53000)
1-O-(α-D-galactopyranosyl)-N-tetracosanyl-2-aminononane-1,3,4-triol (CHEBI:495150) has role epitope (CHEBI:53000)
1-O-(α-D-galactopyranuronosyl)-N-tetradecanoyldihydrosphingosine (CHEBI:528825) has role epitope (CHEBI:53000)
1-O-(α-D-galactosyl)-N-hexacosanoylphytosphingosine (CHEBI:466659) has role epitope (CHEBI:53000)
1-O-(1-O-hexadecanoyl-2-O-heptadecanoyl-sn-glycero-3-phosphono)-1D-myo-inositol (CHEBI:45120) has role epitope (CHEBI:53000)
1-O-[6-O-(3-phenylpropanoyl)-α-D-galactopyranosyl]-N-hexacosanoylsphinganine (CHEBI:140668) has role epitope (CHEBI:53000)
1-O-[6-O-(3-phenylpropanoyl)-α-D-galactosyl]-N-hexacosanoylphytosphingosine (CHEBI:140669) has role epitope (CHEBI:53000)
1-O-dodecanoyl-2-O-pentacosanoyl-sn-glycero-3-phosphocholine (CHEBI:44699) has role epitope (CHEBI:53000)
1-O-palmitoyl-2-O-[1-14C]-linoleoyl-sn-glycero-3-phosphocholine (CHEBI:60475) has role epitope (CHEBI:53000)
1-chloro-2,4,6-trinitrobenzene (CHEBI:53053) has role epitope (CHEBI:53000)
1-chloro-2,4-dinitrobenzene (CHEBI:34718) has role epitope (CHEBI:53000)
1-elaidoyl-sn-glycero-3-phosphocholine (CHEBI:72589) has role epitope (CHEBI:53000)
17β-estradiol 6-O-(carboxymethyl)oxime (CHEBI:42319) has role epitope (CHEBI:53000)
1D-myo-inositol 1,2-cyclic phosphate (CHEBI:18426) has role epitope (CHEBI:53000)
2,4,6-trinitrobenzenesulfonic acid (CHEBI:53063) has role epitope (CHEBI:53000)
2,4,6-trinitrophenyl group (CHEBI:53067) has role epitope (CHEBI:53000)
2,4-dinitrophenyl group (CHEBI:53018) has role epitope (CHEBI:53000)
2,6-di-O-(α-D-mannosyl)-1-O-(1,2-di-O-hexadecanoyl-sn-glycero-3-phosphono)-1D-myo-inositol (CHEBI:59530) has role epitope (CHEBI:53000)
2-(acetylamino)naphthalene-1,5-disulfonic acid (CHEBI:45957) has role epitope (CHEBI:53000)
2-endo-amino-2-exo-benzoyl-3-exo-phenylnorbornane (CHEBI:71545) has role epitope (CHEBI:53000)
2-acetamidofluorene (CHEBI:17356) has role epitope (CHEBI:53000)
2-{[(R)-{[4-(aminomethyl)phenyl]amino}{[(1R)-1-phenylethyl]amino}methyl]amino}ethane-1,1-diol (CHEBI:45412) has role epitope (CHEBI:53000)
24G7 epitope (CHEBI:142163) has role epitope (CHEBI:53000)
3',4'-O-disulfo-N-acetyllactosamine (CHEBI:65145) has role epitope (CHEBI:53000)
3,3-dimethylcystein-S-yl group (CHEBI:139233) has role epitope (CHEBI:53000)
3,4-di-O-methyl-α-L-rhamnose (CHEBI:60398) has role epitope (CHEBI:53000)
3,4-dichloroaniline (CHEBI:16767) has role epitope (CHEBI:53000)
3,6-di-O-sulfo-β-D-galactosyl-(1→4)-6-O-sulfo-N-acetyl-β-D-glucosamine (CHEBI:65146) has role epitope (CHEBI:53000)
3,6-di-O-sulfo-β-D-galactosyl-(1→4)-N-acetyl-β-D-glucosamine (CHEBI:65147) has role epitope (CHEBI:53000)
3-O-α-abequopyranosyl-α-D-mannopyranose (CHEBI:59867) has role epitope (CHEBI:53000)
3-O-methyl-α-L-rhamnose (CHEBI:44042) has role epitope (CHEBI:53000)
3-O-sulfo-β-D-galactose (CHEBI:65148) has role epitope (CHEBI:53000)
3-O-{(1R)-1-[(1,3-dihydroxypropan-2-yl)oxy]-2-hydroxyethyl}-2,6-bis-O-{(1S)-1-[(1,3-dihydroxypropan-2-yl)oxy]-2-hydroxyethyl}-β-D-Man-(1→4) -β-D-GlcNAc-(1→4)-3-O-[(1S)-2-hydroxy-1-{[(2S)-1-hydroxypropan-2-yl]oxy}ethyl]-D-GlcNAc-yl group (CHEBI:59031) has role epitope (CHEBI:53000)
3-oxo-N-[(3S)-2-oxopyrrolidin-3-yl]dodecanamide (CHEBI:44612) has role epitope (CHEBI:53000)
3-{[(5-nitrofuran-2-yl)methylidene]amino}-1,3-oxazol-2-one (CHEBI:42603) has role epitope (CHEBI:53000)
4,6-di-O-sulfo-β-D-galactosyl-(1→4)-N-acetyl-β-D-glucosamine (CHEBI:65181) has role epitope (CHEBI:53000)
4,6-dideoxy-4-(3-deoxy-L-glycero-tetronamido)-α-D-Manp2Me-(1→2)-4,6-dideoxy-4-(3-deoxy-L-glycero-tetronamido)-α-D-ManpOMe (CHEBI:59241) has role epitope (CHEBI:53000)
4-(18,20-dihydroxy-26-methoxy-25-methyloctacosyl)phenyl 3,6-di-O-methyl-β-D-Glc-(1→4)-2,3-di-O-methyl-α-L-Rha-(1→2)-3-O-methyl-α-L-Rha (CHEBI:59236) has role epitope (CHEBI:53000)
4-(4-styrylphenylcarbamoyl)butyric acid (CHEBI:45573) has role epitope (CHEBI:53000)
4-({5-[(2-aminoethyl)amino]-2,4-dinitrophenyl}amino)-TEMPO (CHEBI:44491) has role epitope (CHEBI:53000)
4-O-(2-acetamido-2-deoxy-β-D-glucopyranosyl)-5-O-phosphono-D-ribitol (CHEBI:90525) has role epitope (CHEBI:53000)
4-O-(2-acetamido-2-deoxy-β-D-glucopyranosyl)-D-ribitol (CHEBI:90583) has role epitope (CHEBI:53000)
4-O-acetyl-2,3-di-O-methyl-α-L-fucopyranose (CHEBI:59372) has role epitope (CHEBI:53000)
4-[(1S,2R)-3-(4-fluorophenyl)-2-hydroxy-1-(1,2,4-triazol-1-yl)propyl]benzonitrile (CHEBI:42665) has role epitope (CHEBI:53000)
4-[N'-(2-hydroxyethyl)thioureido]-L-benzyl EDTA (CHEBI:42433) has role epitope (CHEBI:53000)
4-aminobutyl β-D-xylopyranoside (CHEBI:84737) has role epitope (CHEBI:53000)
4-methyl-1,4-dihydropyridine-3,5-dicarbaldehyde (CHEBI:75949) has role epitope (CHEBI:53000)
4-nitrophenyl (4-carboxybutyl)phosphonate (CHEBI:44480) has role epitope (CHEBI:53000)
4-nitrophenyl methylphosphonate (CHEBI:44940) has role epitope (CHEBI:53000)
5'-CGAAAGUCCGAUCGGCGUAAUGUCA-3' RNA fragment (CHEBI:84480) has role epitope (CHEBI:53000)
5'-CGTGCTGTTTTTTTTTG-3' (CHEBI:76482) has role epitope (CHEBI:53000)
5'-CGUUCGCG-3' RNA fragment (CHEBI:84463) has role epitope (CHEBI:53000)
5'-GACCCCUG-3' RNA fragment (CHEBI:84434) has role epitope (CHEBI:53000)
5'-GUUUGGCGACGUCCCACAUGAGCC-3' RNA fragment (CHEBI:84482) has role epitope (CHEBI:53000)
5'-TCGAGCTGCCTTCAGTCGT-3' (CHEBI:76480) has role epitope (CHEBI:53000)
5-(2-amino-5,6-dimethyl-1H-benzimidazol-1-yl)pentanoic acid (CHEBI:43007) has role epitope (CHEBI:53000)
5-({4-[2-(1-oxidopiperidin-1-yl)ethyl]phenyl}amino)-5-oxopentanoic acid (CHEBI:44598) has role epitope (CHEBI:53000)
5-[(4,6-diamino-1,3,5-triazin-2-yl)amino]-4-hydroxy-3-[(2-sulfophenyl)diazenyl]naphthalene-2,7-disulfonic acid (CHEBI:45457) has role epitope (CHEBI:53000)
5-[(4-nitrobenzyl)(phosphonomethyl)amino]valeric acid (CHEBI:40413) has role epitope (CHEBI:53000)
5-amino-2-chlorobenzotrifluoride (CHEBI:59245) has role epitope (CHEBI:53000)
6-(α-D-glucosaminyl)-1D-myo-inositol 1,2-cyclic phosphate (CHEBI:52426) has role epitope (CHEBI:53000)
6-[(4-aminobenzyl)amino]-2,3,4,5-tetrahydropyridinium (CHEBI:46087) has role epitope (CHEBI:53000)
6-deoxy-α-L-Talp2,3Ac2-(1→3)-β-D-Glcp-yl group (CHEBI:138259) has role epitope (CHEBI:53000)
6-deoxy-α-L-Talp2Ac3Me-(1→3)-β-D-Glcp-yl group (CHEBI:138257) has role epitope (CHEBI:53000)
6-{4-[hydroxy-(4-nitrophenoxy)phosphoryl]butyrylamino}hexanoic acid (CHEBI:45068) has role epitope (CHEBI:53000)
8-benzyl-7-hydroxy-4,10-dioxo-1-phenyl-6-oxa-3,9-diaza-7-phosphatetradecan-14-oic acid 7-oxide (CHEBI:43081) has role epitope (CHEBI:53000)
9-deoxy-9-acetamido-α-N-acetylneuraminyl-(2→6)-β-D-galactosyl-(1→4)-N-acetyl-β-D-glucosamine (CHEBI:65189) has role epitope (CHEBI:53000)
9-deoxy-9-acetamido-N-acetyl-α-neuraminic acid (CHEBI:65188) has role epitope (CHEBI:53000)
N,O-(Dnp)2-Tyr-Gln (CHEBI:72484) has role epitope (CHEBI:53000)
N-(5'-phosphonatopyridoxyl)-D-alaninate(2−) (CHEBI:59762) has role epitope (CHEBI:53000)
N-(5'-phosphonatopyridoxyl)-L-alaninate(2−) (CHEBI:59763) has role epitope (CHEBI:53000)
N-(5'-phosphopyridoxyl)-D-alanine (CHEBI:44743) has role epitope (CHEBI:53000)
N-(5'-phosphopyridoxyl)-L-alanine (CHEBI:44770) has role epitope (CHEBI:53000)
N-(p-nitrophenylphosphobutanoyl)glycine (CHEBI:44930) has role epitope (CHEBI:53000)
N-(trans-4'-nitro-4-stilbenyl)-N-methyl-5-aminopentanoic acid (CHEBI:46151) has role epitope (CHEBI:53000)
N-[4-(4-nitrophenylphospho)butanoyl]-D-alanine (CHEBI:45002) has role epitope (CHEBI:53000)
N-[4-(4-nitrophenylphospho)butanoyl]-L-alanine (CHEBI:59565) has role epitope (CHEBI:53000)
N-Ac-Asp-N6-lipoyl-KATIGFEVQEE (CHEBI:60738) has role epitope (CHEBI:53000)
N-acetyl-α-D-galactosamine (CHEBI:40356) has role epitope (CHEBI:53000)
N-acetyl-α-D-galactosaminyl group (CHEBI:88142) has role epitope (CHEBI:53000)
N-acetyl-α-D-galactosaminyl-(1→3)-[α-L-fucosyl-(1→2)]-β-D-galactose derivative (CHEBI:140559) has role epitope (CHEBI:53000)
N-acetyl-α-D-galactosaminyl-L-serine residue (CHEBI:53604) has role epitope (CHEBI:53000)
N-acetyl-α-neuraminic acid (CHEBI:49026) has role epitope (CHEBI:53000)
N-acetyl-α-neuraminyl-(2→3)-β-D-galactosyl-(1→4)-β-D-glucose (CHEBI:59226) has role epitope (CHEBI:53000)
N-acetyl-α-neuraminyl-(2→6)-N-acetyl-α-D-galactosamine (CHEBI:61818) has role epitope (CHEBI:53000)
N-acetyl-β-D-galactosamine (CHEBI:28497) has role epitope (CHEBI:53000)
N-acetyl-β-D-galactosaminyl-(1→4)-N-acetyl-β-D-glucosaminyl group (CHEBI:62190) has role epitope (CHEBI:53000)
N-acetyl-β-D-glucosamine (CHEBI:28009) has role epitope (CHEBI:53000)
N-acetyl-β-D-glucosaminyl-(1→4)-N-acetyl-β-D-glucosamine (CHEBI:50670) has role epitope (CHEBI:53000)
N-acetyl-β-neuraminic acid (CHEBI:45744) has role epitope (CHEBI:53000)
N-acetyl-β-neuraminyl-(2→6)-N-acetyl-α-D-galactosamine (CHEBI:71557) has role epitope (CHEBI:53000)
N-acetylneuraminyl group (CHEBI:75133) has role epitope (CHEBI:53000)
N-glycoloyl-β-D-glucosamine (CHEBI:72626) has role epitope (CHEBI:53000)
N-methylmesoporphyrin (CHEBI:44085) has role epitope (CHEBI:53000)
N-octanoylisoglobotriaosyl ceramide (CHEBI:59528) has role epitope (CHEBI:53000)
N-{β-D-Man-(1→2)-β-D-Man-(1→2)-β-D-ManO[CH2]3S[CH2]2NHC(O)[CH2O]4C(O)[CH2]2S[CH2]2C(O)}-YGKDVKDLFDYAQE-NH-[CH2O]3[CH2]2C(O)NHC(CO2H)[CH2]4N3 (CHEBI:141770) has role epitope (CHEBI:53000)
N2-(5'-phosphopyridoxyl)-L-lysine (CHEBI:44759) has role epitope (CHEBI:53000)
N6-acetyl-N2-(5'-phosphonatopyridoxyl)-L-lysinate(2−) (CHEBI:59766) has role epitope (CHEBI:53000)
N6-acetyl-N2-(5'-phosphopyridoxyl)-L-lysine (CHEBI:59767) has role epitope (CHEBI:53000)
N6-dansyl-L-lysine (CHEBI:42024) has role epitope (CHEBI:53000)
N6-Dnp-Lys-NH2 (CHEBI:72492) has role epitope (CHEBI:53000)
O-(2-aminopropyl)-O'-(2-methyoxyethyl)octa(propylene glycol) (CHEBI:43542) has role epitope (CHEBI:53000)
O-[N-acetyl-α-neuraminyl-(2→6)-N-acetyl-α-D-galactosaminyl]-L-serine residue (CHEBI:53606) has role epitope (CHEBI:53000)
O-hydroxy(phenyl)phosphinoyl ecgonine methyl ester (CHEBI:273574) has role epitope (CHEBI:53000)
p-nitrobenzyl glutaryl glycinic acid (CHEBI:44939) has role epitope (CHEBI:53000)
p-nitrophenylphosphocholine (CHEBI:55394) has role epitope (CHEBI:53000)
P. aeruginosa serotype O11 O-specific polysaccharide (CHEBI:59866) has role epitope (CHEBI:53000)
S-adenosyl-L-homocysteine (CHEBI:16680) has role epitope (CHEBI:53000)
trans-4-(dimethylphenylsilyl)-N-methylpiperidine N-oxide (CHEBI:59555) has role epitope (CHEBI:53000)
D-α-D-Hepp-(1→6)-β-D-Glcp (CHEBI:60563) has role epitope (CHEBI:53000)
L-glycero-α-D-manno-Hepp-(1→2)-L-glycero-α-D-manno-Hepp-(1→3)-L-glycero-α-D-manno-Hepp-(1→5)-α-Kdo (CHEBI:59519) has role epitope (CHEBI:53000)
L-idopyranose 6-monomycolate (CHEBI:42782) has role epitope (CHEBI:53000)
L-Thr-(N→6)-α-D-Galp6d3OAc-(1→3)-β-D-GalpNAc (CHEBI:59415) has role epitope (CHEBI:53000)
[3)-α-D-Galp-(1→3)-β-D-Galf2Ac-(1→]n (CHEBI:139341) has role epitope (CHEBI:53000)
[3)-β-D-Glcp-(1→]5 (CHEBI:136431) has role epitope (CHEBI:53000)
[3)-β-D-Glcp6,NAc2-(1→] residue (CHEBI:83254) has role epitope (CHEBI:53000)
[3)-β-D-GlcpNAc-(1→4)-α-L-Rhap-(1→]n (CHEBI:60498) has role epitope (CHEBI:53000)
[3)-6-deoxy-α-L-Talp-(1→3)-β-D-Glcp-(1→]n (CHEBI:138231) has role epitope (CHEBI:53000)
[3)-6-deoxy-α-L-Talp2,4Ac2-(1→3)-β-D-Glcp-(1→]n (CHEBI:138254) has role epitope (CHEBI:53000)
[3)-6-deoxy-α-L-Talp2Ac-(1→3)-β-D-Glcp-(1→]n (CHEBI:138250) has role epitope (CHEBI:53000)
[3)-6-deoxy-α-L-Talp2Me-(1→3)-β-D-Glcp-(1→]n (CHEBI:138252) has role epitope (CHEBI:53000)
[3)-6-deoxy-α-L-Talp4Ac2Me-(1→3)-β-D-Glcp-(1→]n (CHEBI:138253) has role epitope (CHEBI:53000)
[4)-α-D-Galp-(1→3)-β-D-Galf-(1→]n (CHEBI:60500) has role epitope (CHEBI:53000)
[4)-α-D-GalNAcAN-(1→4)-α-D-GalNAcAN-(1→3)-β-D-QuiNAc-(1→2)-β-D-QuiN4Fm-(1→4)-α-D-GalNAcAN-(1→4)-α-D-GalNAcAN-(1→]n (CHEBI:76134) has role epitope (CHEBI:53000)
[4)-α-D-Glcp-(1→4)-α-D-Glcp-(1→4)-α-D-Glcp-(1→] residue (CHEBI:85467) has role epitope (CHEBI:53000)
[4)-β-D-Galp-(1→3)-β-D-Galp-(1→3)-β-D-GalpNAc-(1→]n (CHEBI:60499) has role epitope (CHEBI:53000)
[N-(4-cyanophenyl)-N'-(diphenylmethyl)guanidine]acetic acid (CHEBI:385425) has role epitope (CHEBI:53000)
acenaphthoquinone (CHEBI:15342) has role epitope (CHEBI:53000)
argpyrimidine (CHEBI:59962) has role epitope (CHEBI:53000)
benzylpenamaldate group (CHEBI:139234) has role epitope (CHEBI:53000)
benzylpenamidyl group (CHEBI:139225) has role epitope (CHEBI:53000)
benzylpenicanyl group (CHEBI:139229) has role epitope (CHEBI:53000)
benzylpenicillenyl group (CHEBI:139227) has role epitope (CHEBI:53000)
benzylpenicillin (CHEBI:18208) has role epitope (CHEBI:53000)
benzylpenicilloic acid (CHEBI:61222) has role epitope (CHEBI:53000)
benzylpenicilloyl group (CHEBI:53702) has role epitope (CHEBI:53000)
benzylpenilloic acid (CHEBI:139245) has role epitope (CHEBI:53000)
beryllium atom (CHEBI:30501) has role epitope (CHEBI:53000)
ciguatoxin ABC ring fragment (CHEBI:70750) has role epitope (CHEBI:53000)
ciguatoxin ABCDE ring fragment (CHEBI:70748) has role epitope (CHEBI:53000)
ciguatoxin JKLM ring fragment (CHEBI:60927) has role epitope (CHEBI:53000)
CII259-273 (CHEBI:62385) has role epitope (CHEBI:53000)
decarboxysuprofen (CHEBI:64707) has role epitope (CHEBI:53000)
decarboxytiaprofenic acid (CHEBI:64706) has role epitope (CHEBI:53000)
Dig-Cy5 (CHEBI:72459) has role epitope (CHEBI:53000)
digoxin (CHEBI:4551) has role epitope (CHEBI:53000)
Dnp-Asn-Gln (CHEBI:72486) has role epitope (CHEBI:53000)
Dnp-Gln (CHEBI:72487) has role epitope (CHEBI:53000)
Dnp-Nor-Gln (CHEBI:72494) has role epitope (CHEBI:53000)
Dnp-Sar-Gln (CHEBI:72489) has role epitope (CHEBI:53000)
Dnp-Thr-Gln (CHEBI:72482) has role epitope (CHEBI:53000)
Dnp-Trp-Gln (CHEBI:72488) has role epitope (CHEBI:53000)
dT4 (CHEBI:75602) has role epitope (CHEBI:53000)
dT6 (CHEBI:75683) has role epitope (CHEBI:53000)
dT8 (CHEBI:75597) has role epitope (CHEBI:53000)
dTT(6-4)TT (CHEBI:74749) has role epitope (CHEBI:53000)
ecgonine benzoate (CHEBI:41001) has role epitope (CHEBI:53000)
ENPAVHFFKNIVTPRTP (CHEBI:86312) has role epitope (CHEBI:53000)
ENPVVAFFKNIVTPRTP (CHEBI:86310) has role epitope (CHEBI:53000)
ENPVVHFFFNIVTPRTP (CHEBI:86303) has role epitope (CHEBI:53000)
ENPVVHFFKNIVTPRTP (CHEBI:86237) has role epitope (CHEBI:53000)
ENPVVHFFYNIVTPRTP (CHEBI:86306) has role epitope (CHEBI:53000)
estriol 3-O-(β-D-glucuronide) (CHEBI:45869) has role epitope (CHEBI:53000)
ethyl dihydrogen phosphate (CHEBI:42383) has role epitope (CHEBI:53000)
ethyl hydrogen phosphate(1−) (CHEBI:59759) has role epitope (CHEBI:53000)
ethyl phosphate(2−) (CHEBI:59760) has role epitope (CHEBI:53000)
flucofuron (CHEBI:59242) has role epitope (CHEBI:53000)
fluorescein-DNP hapten (CHEBI:72498) has role epitope (CHEBI:53000)
glyoxal-lysine dimer (CHEBI:59965) has role epitope (CHEBI:53000)
HS44 (CHEBI:72586) has role epitope (CHEBI:53000)
isopentenyl diphosphate (CHEBI:16584) has role epitope (CHEBI:53000)
isopentenyl diphosphate(3−) (CHEBI:128769) has role epitope (CHEBI:53000)
keto mycolic acid (CHEBI:59234) has role epitope (CHEBI:53000)
Lys-GalA (CHEBI:138978) has role epitope (CHEBI:53000)
Lys-Thr-Trp-Gly-Lys-Asn-Leu-Val-Phe (CHEBI:85088) has role epitope (CHEBI:53000)
methacholine (CHEBI:6804) has role epitope (CHEBI:53000)
methoxy mycolic acid (CHEBI:59233) has role epitope (CHEBI:53000)
methyl 4,6-dideoxy-4-(3-deoxy-L-glycero-tetronamido)-2-O-methyl-α-D-mannopyranoside (CHEBI:43892) has role epitope (CHEBI:53000)
methyl dihydrogen phosphate (CHEBI:340824) has role epitope (CHEBI:53000)
methyl nonanoate (CHEBI:44499) has role epitope (CHEBI:53000)
methyl phosphate(2−) (CHEBI:59761) has role epitope (CHEBI:53000)
methylglyoxal-lysine dimer (CHEBI:59963) has role epitope (CHEBI:53000)
nickel atom (CHEBI:28112) has role epitope (CHEBI:53000)
oregon green 488 (CHEBI:44777) has role epitope (CHEBI:53000)
ornidazole (CHEBI:75176) has role epitope (CHEBI:53000)
Phe(4-NO2)-Gln (CHEBI:72496) has role epitope (CHEBI:53000)
phenolic phthiocerol (CHEBI:59237) has role epitope (CHEBI:53000)
phosphocholine (CHEBI:18132) has role epitope (CHEBI:53000)
phthalaldehyde (CHEBI:70851) has role epitope (CHEBI:53000)
phthiocerol (CHEBI:59240) has role epitope (CHEBI:53000)
prenyl diphosphate (CHEBI:16057) has role epitope (CHEBI:53000)
prenyl diphosphate(3−) (CHEBI:57623) has role epitope (CHEBI:53000)
QSPSYPDREYSDEDRQIKQMLHQECPRL-NH2 (CHEBI:84736) has role epitope (CHEBI:53000)
Reactive Red 6 hapten copper complex (CHEBI:72307) has role epitope (CHEBI:53000)
secnidazole (CHEBI:140628) has role epitope (CHEBI:53000)
sodium amoxicilloyl group (CHEBI:133976) has role epitope (CHEBI:53000)
sulcofuron (CHEBI:59246) has role epitope (CHEBI:53000)
sulcofuron-sodium (CHEBI:59247) has role epitope (CHEBI:53000)
sulfamethoxazole (CHEBI:9332) has role epitope (CHEBI:53000)
Tnp-Gln (CHEBI:72495) has role epitope (CHEBI:53000)
trimellitic anhydride (CHEBI:53050) has role epitope (CHEBI:53000)
Trp-Gly-Ile-His-His (CHEBI:140075) has role epitope (CHEBI:53000)
Trp-Tyr-Gly-Tyr-His-His (CHEBI:140076) has role epitope (CHEBI:53000)
Synonyms Sources
antigenic determinant ChEBI
epitope function ChEBI
epitope role ChEBI
Last Modified
13 November 2018