CHEBI:53000 - epitope

Main ChEBI Ontology Automatic Xrefs Reactions Pathways Models
ChEBI Name epitope
ChEBI ID CHEBI:53000
Definition The biological role played by a material entity when bound by a receptor of the adaptive immune system. Specific site on an antigen to which an antibody binds.
Stars This entity has been manually annotated by the ChEBI Team.
Members of epitope Class Download as Tab-delimited, XML, SDF
estriol 3-O-(beta-D-glucuronide)
Mass :464.50550
Formula : C24H32O9
p-nitrobenzyl glutaryl glycinic acid
Mass :323.30130
Formula : C14H17N3O6
4-nitrophenyl (4-carboxybutyl)phosphonate
Mass :302.19720
Formula : C11H13NO7P
digoxin
Mass :780.93850
Formula : C41H64O14
4-nitrophenyl methylphosphonate
Mass :216.10790
Formula : C7H7NO5P
4-[N'-(2-hydroxyethyl)thioureido]-L-benzyl EDTA
Mass :500.52300
Formula : C20H28N4O9S
beta-D-Galp6P-(1->4)-alpha-D-Manp
Mass :422.27640
Formula : C12H23O14P
beta-D-Galp-(1->3)-beta-D-Galp6P-(1->4)-alpha-D-Manp
Mass :584.41700
Formula : C18H33O19P
N-[4-(4-nitrophenylphospho)butanoyl]-D-alanine
Mass :360.257
Formula : C13H17N2O8P
N-[4-(4-nitrophenylphospho)butanoyl]-L-alanine
Mass :360.257
Formula : C13H17N2O8P
N-(p-nitrophenylphosphobutanoyl)glycine
Mass :346.22990
Formula : C12H15N2O8P
17beta-estradiol 6-O-(carboxymethyl)oxime
Mass :359.41620
Formula : C20H25NO5
5-[(4-nitrobenzyl)(phosphonomethyl)amino]valeric acid
Mass :346.27290
Formula : C13H19N2O7P
p-nitrophenylphosphocholine
Mass :305.24420
Formula : C11H18N2O6P
beta-D-glucosyl-N-(octadecanoyl)sphinganine
Mass :730.11030
Formula : C42H83NO8
sulfamethoxazole
Mass :253.279
Formula : C10H11N3O3S
nickel atom
Mass :58.69340
Formula : Ni
2,4-dinitrophenyl group
Mass :167.09900
Formula : C6H3N2O4
1-chloro-2,4-dinitrobenzene
Mass :202.55200
Formula : C6H3ClN2O4
trimellitic anhydride
Mass :192.12510
Formula : C9H4O5
methacholine
Mass :160.23406
Formula : C8H18NO2
1-chloro-2,4,6-trinitrobenzene
Mass :247.55000
Formula : C6H2ClN3O6
2,4,6-trinitrobenzenesulfonic acid
Mass :293.16800
Formula : C6H3N3O9S
2,4,6-trinitrophenyl group
Mass :212.09660
Formula : C6H2N3O6
beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-D-GlcpNAc
Mass :529.48960
Formula : C20H35NO15
QSPSYPDREYSDEDRQIKQMLHQECPRL-NH2
Mass :3448.75600
Formula : C145H227N45O49S2
Dig-Cy5
Mass :1131.44200
Formula : C60H82N4O13S2
alpha-Neup5Gc-(2->3)-beta-D-Galp-(1->3)-beta-D-GlcNAcp
Mass :690.60240
Formula : C25H42N2O20
beta-Neup5Gc-(2->6)-beta-D-Galp-(1->4)-D-GlcpNAc
Mass :690.60240
Formula : C25H42N2O20
alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-GlcpNAc
Mass :586.54090
Formula : C22H38N2O16
beta-D-GlcpA-(1->3)-beta-D-GlcpNAc
Mass :397.33190
Formula : C14H23NO12
beta-D-GlcpA-(1->6)-beta-D-Galp
Mass :356.28000
Formula : C12H20O12
alpha-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc
Mass :586.54090
Formula : C22H38N2O16
alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->3)-D-GalpNAc
Mass :586.54090
Formula : C22H38N2O16
beta-D-GlcpNAc-(1->2)-beta-D-Galp-(1->3)-alpha-D-GalpNAc
Mass :586.54090
Formula : C22H38N2O16
alpha-D-galactosyl-(1->3)-alpha-D-galactose
Mass :342.29650
Formula : C12H22O11
alpha-D-galactosyl-(1->2)-alpha-D-galactose
Mass :342.29650
Formula : C12H22O11
prenyl diphosphate
Mass :246.09210
Formula : C5H12O7P2
prenyl diphosphate(3-)
Mass :243.06830
Formula : C5H9O7P2
(2E)-4-hydroxy-3-methylbut-2-enyl diphosphate(3-)
Mass :259.06770
Formula : C5H9O8P2
(2E)-4-hydroxy-3-methylbut-2-en-1-yl diphosphate
Mass :262.09150
Formula : C5H12O8P2
isopentenyl diphosphate
Mass :246.09210
Formula : C5H12O7P2
isopentenyl diphosphate(3-)
Mass :243.06830
Formula : C5H9O7P2
ethyl hydrogen phosphate(1-)
Mass :125.04040
Formula : C2H6O4P
ethyl dihydrogen phosphate
Mass :126.04830
Formula : C2H7O4P
ethyl phosphate(2-)
Mass :124.03250
Formula : C2H5O4P
methyl dihydrogen phosphate
Mass :112.02180
Formula : CH5O4P
methyl phosphate(2-)
Mass :110.00590
Formula : CH3O4P
N-(5'-phosphonatopyridoxyl)-D-alaninate(2-)
Mass :318.21980
Formula : C11H15N2O7P
N-(5'-phosphonatopyridoxyl)-L-alaninate(2-)
Mass :318.21980
Formula : C11H15N2O7P
N-(5'-phosphopyridoxyl)-L-alanine
Mass :320.23560
Formula : C11H17N2O7P
N(6)-acetyl-N(2)-(5'-phosphonatopyridoxyl)-L-lysinate(2-)
Mass :417.35080
Formula : C16H24N3O8P
N(6)-acetyl-N(2)-(5'-phosphopyridoxyl)-L-lysine
Mass :419.36670
Formula : C16H26N3O8P
argpyrimidine
Mass :254.28560
Formula : C11H18N4O3
methylglyoxal-lysine dimer
Mass :341.42590
Formula : C16H29N4O4
glyoxal-lysine dimer
Mass :327.39930
Formula : C15H27N4O4
alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp
Mass :504.43710
Formula : C18H32O16
beta-(1->3)-galactobiose
Mass :342.29650
Formula : C12H22O11
beta-D-Galp-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc
Mass :545.48900
Formula : C20H35NO16
beta-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-GlcpNAc
Mass :586.54090
Formula : C22H38N2O16
beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc
Mass :627.59280
Formula : C24H41N3O16
beta-D-GlcpNAc-(1->6)-alpha-D-GalpNAc
Mass :424.40030
Formula : C16H28N2O11
alpha-KDN-(2->3)-beta-D-Galp-(1->3)-alpha-D-GalpNAc
Mass :633.55110
Formula : C23H39NO19
alpha-KDN-(2->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc
Mass :633.55110
Formula : C23H39NO19
alpha-KDN-(2->3)-beta-D-Galp-(1->4)-D-Glcp
Mass :592.49910
Formula : C21H36O19
alpha-KDN-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc
Mass :633.55110
Formula : C23H39NO19
alpha-KDN-(2->6)-beta-D-Galp-(1->4)-D-GlcpNAc
Mass :633.55110
Formula : C23H39NO19
5'-GACCCCUG-3' RNA fragment
Mass :2484.54300
Formula : C75H96N29O54P7
5'-CGUUCGCG-3' RNA fragment
Mass :2501.52710
Formula : C75H95N28O56P7
beta-D-Tyvp-(1->3)-beta-D-GalpN-OMe
Mass :323.33950
Formula : C13H25NO8
beta-D-Tyvp-(1->3)-beta-D-GalpNAc6,OMe2
Mass :379.40280
Formula : C16H29NO9
beta-D-Tyvp2Me-(1->3)-beta-D-GalpNAc-OMe
Mass :379.40280
Formula : C16H29NO9
benzylpenicilloic acid
Mass :352.40500
Formula : C16H20N2O5S
benzylpenilloic acid
Mass :308.398
Formula : C15H20N2O3S
1-O-(alpha-D-galactopyranosyl)-N-hexacosanoylsphinganine
Mass :842.32300
Formula : C50H99NO8
alpha-D-galactosyl-(1->4)-beta-D-galactosyl group
Mass :325.290
Formula : C12H21O10
alpha-N-acetylneuraminyl-(2->3)-D-galactosyl group
Mass :454.40310
Formula : C17H28NO13
alpha-L-fucose
Mass :164.15650
Formula : C6H12O5
N-acetyl-alpha-D-galactosamine
Mass :221.20780
Formula : C8H15NO6
alpha-L-rhamnopyranose
Mass :164.15648
Formula : C6H12O5
N-acetyl-alpha-neuraminic acid
Mass :309.26990
Formula : C11H19NO9
N-acetyl-beta-neuraminic acid
Mass :309.26990
Formula : C11H19NO9
beta-D-glucose
Mass :180.15588
Formula : C6H12O6
N-acetyl-beta-D-galactosamine
Mass :221.20784
Formula : C8H15NO6
N-glycoloyl-beta-D-glucosamine
Mass :237.20720
Formula : C8H15NO7
beta-D-GalpNAc-(1->4)-[alpha-Neup5Ac-(2->3)]-D-Galp
Mass :674.604
Formula : C25H42N2O19
beta-D-Galp-(1->3)-D-GlcpNAc
Mass :383.350
Formula : C14H25NO11 C14H25NO11
beta-D-Galp-(1->3)-D-GalpNAc
Mass :383.34840
Formula : C14H25NO11
alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group
Mass :528.48170
Formula : C20H34NO15
2-endo-amino-2-exo-benzoyl-3-exo-phenylnorbornane
Mass :291.38680
Formula : C20H21NO
alpha-D-Manp-(1->6)-beta-D-Manp
Mass :342.29650
Formula : C12H22O11
Graph View Tree View
panning
Move up
Move left
Move down
Move right
Graph compression

Simplified view Show me the possible minimal nodes in this graph
Full view Show me all the nodes in this graph
Personalised view Create your own personalised ontology view, if you wish to remove any entity from your future visualisations please right click the entity (e.g. molecular entity)
My hidden entities
Edit
+Zoom in
-Zoom out
Download
Enter fullscreen