Dbfetch
ID U70429; SV 1; linear; mRNA; STD; MUS; 2059 BP. XX AC U70429; XX DT 05-APR-1997 (Rel. 51, Created) DT 24-SEP-2008 (Rel. 97, Last updated, Version 5) XX DE Mus musculus interleukin-4 induced gene-1 (Fig1) mRNA, complete cds. XX KW . XX OS Mus musculus (house mouse) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; OC Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; OC Murinae; Mus; Mus. XX RN [1] RP 1-2059 RX DOI; 10.1073/pnas.94.6.2507. RX PUBMED; 9122225. RA Chu C.C., Paul W.E.; RT "Fig1, an interleukin 4-induced mouse B cell gene isolated by cDNA RT representational difference analysis"; RL Proc. Natl. Acad. Sci. U.S.A. 94(6):2507-2512(1997). XX RN [2] RP 1-2059 RA Chu C.C., Paul W.E.; RT ; RL Submitted (11-SEP-1996) to the INSDC. RL Laboratory of Immunology, NIAID, Building 10, Room 11N311, Bethesda, MD RL 20892-1892, USA XX DR MD5; 7ac1bc0091c367c987b3d128102de96e. DR EuropePMC; PMC20118; 9122225. DR EuropePMC; PMC529166; 15557650. XX FH Key Location/Qualifiers FH FT source 1..2059 FT /organism="Mus musculus" FT /chromosome="7" FT /map="between Klk1 and Ldh3" FT /mol_type="mRNA" FT /cell_type="B cell" FT /tissue_type="spleen" FT /db_xref="taxon:10090" FT source 1..917 FT /organism="Mus musculus" FT /strain="BALB/C" FT /mol_type="mRNA" FT /note="5' RACE, and cDNA representational difference FT analysis" FT /db_xref="taxon:10090" FT source 537..2059 FT /organism="Mus musculus" FT /strain="CBA/J" FT /mol_type="mRNA" FT /clone_lib="Clontech IL-4 induced splenic B cell cDNA FT library" FT /db_xref="taxon:10090" FT 5'UTR 1..50 FT /gene="Fig1" FT CDS 51..1943 FT /codon_start=1 FT /gene="Fig1" FT /product="Fig-1 protein" FT /note="interleukin-four induced gene-1; similar to some FT flavoproteins, most specifically to monoamine oxidases" FT /db_xref="GOA:O09046" FT /db_xref="InterPro:IPR001613" FT /db_xref="InterPro:IPR002937" FT /db_xref="InterPro:IPR036188" FT /db_xref="MGI:MGI:109552" FT /db_xref="PDB:2I8W" FT /db_xref="UniProtKB/Swiss-Prot:O09046" FT /func_characterised="identical sequence" FT /protein_id="AAB51353.1" FT /translation="MAGLALRLVLAATLLGLAGSLDWKAASSLNPIEKCMEDHDYEQLL FT KVVTLGLNRTSKPQKVVVVGAGVAGLVAAKMLSDAGHKVTILEADNRIGGRIFTFRDEK FT TGWIGELGAMRMPSSHRILHKLCRTLGLNLTQFTQYDENTWTEVHNVKLRNYVVEKMPE FT KLGYNLNNRERGHSPEDIYQMALNKAFKDLKALGCKKAMNKFNKHTLLEYLLEEGNLSR FT PAVQLLGDVMSEEGFFYLSFAEALRAHACLSDRLRYSRIVGGWDLLPRALLSSLSGALL FT LNAPVVSITQGRNDVRVHIATSLHSEKTLTADVVLLTASGPALQRITFSPPLTRKRQEA FT LRALHYVAASKVFLSFRRPFWHEEHIEGGHSNTDRPSRLIFYPARGEGSLLLASYTWSD FT AAAPFAGLSTDQTLRLVLQDVAALHGPVVFRLWDGRGVVKRWAEDPHSQGGFVVQPPLY FT GREAEDYDWSAPFGRIYFAGEHTALPHGWVETAVKSGLRAAVRINNNYGYGEVDPQMME FT HAYAEANYLDQYPEGERPEEQQAREEVSPDEQEPSHKHLLVETSPEGQQHAFVEAIPEL FT QGHVFVETVPQEKGHAHQNIYPSEHVQVHGEVIPEWHGHGGSGTPQMHRVGDHS" FT sig_peptide 51..113 FT /gene="Fig1" FT /note="encodes hydrophobic domain as predicted by the GES FT (Goldman, Engelman and Steitz) method" FT misc_feature 171..173 FT /gene="Fig1" FT /note="encodes tyrosine 41, a putative tyrosine FT phosphorylation site (KXXEXXXY)" FT misc_feature 207..467 FT /gene="Fig1" FT /note="encodes a region which is similar to many FT FAD-binding and NAD-binding proteins" FT misc_feature 207..215 FT /gene="Fig1" FT /note="encodes putative N-linked glycosylation site (NXT)" FT misc_feature 228..314 FT /gene="Fig1" FT /note="encodes putative FAD-binding domain 1 by similarity FT to beta-alpha-beta dinucleotide fold; binds ADP" FT misc_feature 231..287 FT /gene="Fig1" FT /note="encodes hydrophobic domain as predicted by the GES FT method" FT misc_feature 299..300 FT /gene="Fig1" FT /note="splice site; deduced from 5' RACE clones" FT misc_feature 327..350 FT /gene="Fig1" FT /note="encodes putative FAD-binding domain 2 by similarity FT to monoamine oxidase B; binds ribityl moiety" FT misc_feature 412..413 FT /gene="Fig1" FT /note="splice site; deduced from precursor RNA (Fig1ps, FT U70430)" FT misc_feature 414..917 FT /gene="Fig1" FT /note="DNA fragment in clone 20-8T#22" FT misc_feature 414..614 FT /gene="Fig1" FT /note="5' end of DNA fragment in clone 20-8T#17" FT misc_feature 447..455 FT /gene="Fig1" FT /note="encodes putative N-linked glycosylation site (NXT)" FT misc_feature 549..551 FT /gene="Fig1" FT /note="encodes tyrosine 167, a putative tyrosine FT phosphorylation site (KXXEXXXY)" FT misc_feature 614..615 FT /gene="Fig1" FT /note="splice site; deduced from precrsor RNA (Fig1ps, FT U70430)" FT misc_feature 683..684 FT /gene="Fig1" FT /note="splice site; deduced from genomic fragment (U80211)" FT misc_feature 705..713 FT /gene="Fig1" FT /note="encodes putative N-linked glycosylation site (NXT)" FT misc_feature 828..944 FT /gene="Fig1" FT /note="encodes a region which is similar to monoamine FT oxidase B" FT misc_feature 858..908 FT /gene="Fig1" FT /note="encodes hydrophobic domain as predicted by the GES FT method" FT misc_feature 894..914 FT /gene="Fig1" FT /note="encodes putative FAD-binding domain 3 by similarity FT to dinucleotide fold" FT misc_feature 972..1025 FT /gene="Fig1" FT /note="encodes hydrophobic domain as predicted by the GES FT method" FT misc_feature 972..1016 FT /gene="Fig1" FT /note="encodes a region which is similar to Arabidopsis FT thaliana phytoene desaturase" FT misc_feature 984..1010 FT /gene="Fig1" FT /note="encodes putative FAD-binding domain 4 by similarity FT to dinucleotide fold" FT misc_feature 1026..1142 FT /gene="Fig1" FT /note="encodes a region which is similar to monoamine FT oxidase B" FT misc_feature 1119..1259 FT /gene="Fig1" FT /note="encodes possible active site by similarity to FT fumarate reductase/succinate dehydrogenase (FRD/SDH) family FT of proteins" FT misc_feature 1206..1271 FT /gene="Fig1" FT /note="encodes hydrophobic domain as predicted by the GES FT method" FT misc_feature 1218..1328 FT /gene="Fig1" FT /note="encodes a region which is similar to tryptophan FT 2-monooxygenase" FT misc_feature 1365..1571 FT /gene="Fig1" FT /note="encodes putative FAD-binding domain 5 by similarity FT to monoamine oxidase; binds FAD" FT misc_feature 1365..1496 FT /gene="Fig1" FT /note="encodes a region which is similar to monoamine FT oxidase B" FT misc_feature 1509..1571 FT /gene="Fig1" FT /note="encodes a region which is similar to monoamine FT oxidase B" FT 3'UTR 1944..2059 FT /gene="Fig1" FT variation 2000 FT /gene="Fig1" FT /replace="g" FT /note="compare to Fig1ps sequence in GenBank Accession FT Number U70430" FT /citation FT regulatory 2022..2027 FT /gene="Fig1" FT /regulatory_class="polyA_signal_sequence" FT variation 2043..2046 FT /gene="Fig1" FT /note="deletion of ccac; compare to Fig1ps sequence in FT GenBank Accession Number U70430" FT /citation FT polyA_site 2047..2059 FT /gene="Fig1" XX SQ Sequence 2059 BP; 460 A; 581 C; 636 G; 382 T; 0 other; gtctgcagtc ctgcccaaga gagctgaaga cagcagctgc cacttgagcc atggctgggc 60 tggccctgcg tcttgtcctg gcggccaccc tccttggtct ggcaggctct ctggactgga 120 aggcagcctc cagcttgaac cctattgaga agtgtatgga ggaccacgat tatgagcagc 180 tactcaaggt ggtgaccttg ggcctcaatc ggacttcgaa gccccagaag gtggtagtgg 240 ttggtgcagg cgtggcaggg ctggtagcag ccaagatgct cagtgatgca ggacacaagg 300 tcaccatcct ggaggcagat aacaggattg ggggccgtat cttcactttc cgggatgaga 360 agacaggctg gataggggag cttggggcca tgcgaatgcc cagctctcac aggatcttgc 420 acaagctctg caggaccctg ggcctcaacc tgactcagtt cacacagtat gatgagaaca 480 cgtggacgga ggtgcataat gtgaagctgc gaaactatgt ggtggagaag atgccagaaa 540 agctgggcta caacctgaac aacagggaaa ggggccattc cccagaggac atctaccaga 600 tggcactcaa caaggccttc aaagacctca aggccttggg ctgcaagaaa gccatgaata 660 agttcaacaa gcatacgctt ctggaatacc tcctcgagga gggcaacctg tcccggccgg 720 ctgtgcagct cctgggagat gtgatgtccg aggagggctt cttctacctc agctttgcag 780 aagccttacg tgcgcacgcc tgcctgagcg atagactccg gtacagccgc atcgtaggtg 840 gctgggacct gcttccgcga gctctgctga gctcactgtc cggggcgctg ctactgaacg 900 cgcctgtggt gtcgatcact caggggagga acgatgtacg cgtgcacatt gccacctcgc 960 ttcacagcga gaagacgctg acagccgacg tggtgctgct gactgccagt ggacccgcgc 1020 tgcagcgcat taccttctcg ccgcccttga ctcgcaagag gcaggaggca ctgcgcgcgc 1080 ttcactacgt agcagccagc aaggtttttc tgagtttccg tcggcccttc tggcacgagg 1140 agcacatcga gggcggccac tccaacactg accgcccatc gcgcctcata ttctatcccg 1200 cgcggggcga gggctcactg cttctggcct cctacacgtg gtcggacgct gcagccccct 1260 tcgctggact gagcaccgac cagaccctgc gtttggtgct ccaggacgtg gcggccctgc 1320 acgggcctgt ggtgttccgg ctgtgggacg gcaggggtgt ggtcaagcgc tgggcagagg 1380 acccgcatag ccagggaggc ttcgtggtgc agccgccatt gtacgggcgc gaggctgagg 1440 actatgactg gtcagccccc ttcggccgca tttacttcgc gggcgagcac acagctctcc 1500 cgcatggctg ggtagagacc gctgtcaagt ccgggttgcg ggccgcggtg agaatcaata 1560 ataactatgg gtacggggag gtcgaccccc agatgatgga gcatgcatat gcagaggcca 1620 actatctgga ccagtatcct gaaggggaga ggcccgagga gcagcaggcg cgggaagaag 1680 tcagcccaga tgaacaggag ccctctcaca aacacttgtt ggtggaaacg agccccgagg 1740 ggcagcaaca cgcgtttgtg gaggccattc ccgagctgca gggacacgtg ttcgtggaga 1800 ctgtccccca ggagaagggg cacgcccacc agaatatata tccttcggag catgtacagg 1860 tgcatgggga agtcatccct gagtggcatg gtcatggggg atctggcacc ccgcaaatgc 1920 accgagtggg ggaccactcc taatcgcaaa gaggaagtga gcacccagct cctaagccag 1980 ccctcttcag ggcagacaga ccacctacac taatagccca caataaagtt atttttgtta 2040 aaccacaaaa aaaaaaaaa 2059 //