Dbfetch
ID AB073864; SV 1; linear; mRNA; STD; HUM; 570 BP. XX AC AB073864; XX DT 13-NOV-2001 (Rel. 69, Created) DT 07-OCT-2008 (Rel. 97, Last updated, Version 3) XX DE Homo sapiens mRNA for DJ-1, complete cds. XX KW . XX OS Homo sapiens (human) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; OC Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; OC Homo. XX RN [1] RP 1-570 RA Ariga H.; RT ; RL Submitted (02-NOV-2001) to the INSDC. RL Hiroyoshi Ariga, Graduate School of Pharmaceutical Sciences, Hokkaido RL University, Molecular Biology; Kita 12, Nishi 6, Kita-ku, Sapporo 060-0812, RL Japan (E-mail:hiro@pharm.hokudai.ac.jp, Tel:81-11-706-3745, RL Fax:81-11-706-4988) XX RN [2] RA Ariga H., Niki T.; RT "human DJ-1 cDNA from PC3 cells"; RL Unpublished. XX DR MD5; 8d831e4e99ccc3b65b1f8c56fe83be1e. DR Ensembl-Gn; ENSG00000116288; homo_sapiens. DR Ensembl-Tr; ENST00000338639; homo_sapiens. DR Ensembl-Tr; ENST00000377488; homo_sapiens. DR Ensembl-Tr; ENST00000377491; homo_sapiens. DR Ensembl-Tr; ENST00000493373; homo_sapiens. DR Ensembl-Tr; ENST00000493678; homo_sapiens. DR EuropePMC; PMC521171; 15502868. XX FH Key Location/Qualifiers FH FT source 1..570 FT /organism="Homo sapiens" FT /mol_type="mRNA" FT /cell_line="PC3" FT /cell_type="prostate cancer" FT /db_xref="taxon:9606" FT CDS 1..570 FT /codon_start=1 FT /transl_table=1 FT /gene="dj-1" FT /product="DJ-1" FT /note="a fertility-related and andorogen recepror-positive FT regulator" FT /db_xref="GOA:Q99497" FT /db_xref="H-InvDB:HIT000061228.13" FT /db_xref="HGNC:HGNC:16369" FT /db_xref="InterPro:IPR002818" FT /db_xref="InterPro:IPR006287" FT /db_xref="InterPro:IPR029062" FT /db_xref="PDB:1J42" FT /db_xref="PDB:1P5F" FT /db_xref="PDB:1PDV" FT /db_xref="PDB:1PDW" FT /db_xref="PDB:1PE0" FT /db_xref="PDB:1Q2U" FT /db_xref="PDB:1SOA" FT /db_xref="PDB:1UCF" FT /db_xref="PDB:2OR3" FT /db_xref="PDB:2R1T" FT /db_xref="PDB:2R1U" FT /db_xref="PDB:2R1V" FT /db_xref="PDB:2RK3" FT /db_xref="PDB:2RK4" FT /db_xref="PDB:2RK6" FT /db_xref="PDB:3B36" FT /db_xref="PDB:3B38" FT /db_xref="PDB:3B3A" FT /db_xref="PDB:3BWE" FT /db_xref="PDB:3CY6" FT /db_xref="PDB:3CYF" FT /db_xref="PDB:3CZ9" FT /db_xref="PDB:3CZA" FT /db_xref="PDB:3EZG" FT /db_xref="PDB:3F71" FT /db_xref="PDB:3SF8" FT /db_xref="PDB:4BTE" FT /db_xref="PDB:4MNT" FT /db_xref="PDB:4MTC" FT /db_xref="PDB:4N0M" FT /db_xref="PDB:4N12" FT /db_xref="PDB:4OGF" FT /db_xref="PDB:4OQ4" FT /db_xref="PDB:4P2G" FT /db_xref="PDB:4P34" FT /db_xref="PDB:4P35" FT /db_xref="PDB:4P36" FT /db_xref="PDB:4RKW" FT /db_xref="PDB:4RKY" FT /db_xref="PDB:4S0Z" FT /db_xref="PDB:4ZGG" FT /db_xref="PDB:5IP5" FT /db_xref="PDB:5SY6" FT /db_xref="PDB:5SY9" FT /db_xref="PDB:5SYA" FT /db_xref="PDB:6AF5" FT /db_xref="PDB:6AF7" FT /db_xref="PDB:6AF9" FT /db_xref="PDB:6AFA" FT /db_xref="PDB:6AFB" FT /db_xref="PDB:6AFC" FT /db_xref="PDB:6AFD" FT /db_xref="PDB:6AFE" FT /db_xref="PDB:6AFF" FT /db_xref="PDB:6AFG" FT /db_xref="PDB:6AFH" FT /db_xref="PDB:6AFI" FT /db_xref="PDB:6AFJ" FT /db_xref="PDB:6AFL" FT /db_xref="PDB:6E5Z" FT /db_xref="PDB:6M8Z" FT /db_xref="UniProtKB/Swiss-Prot:Q99497" FT /protein_id="BAB71782.1" FT /translation="MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQ FT CSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQENRKGLIAA FT ICAGPTALLAHEIGCGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFE FT FALAIVEALNGKEVAAQVKAPLVLKD" XX SQ Sequence 570 BP; 154 A; 117 C; 169 G; 130 T; 0 other; atggcttcca aaagagctct ggtcatcctg gctaaaggag cagaggaaat ggagacggtc 60 atccctgtag atgtcatgag gcgagctggg attaaggtca ccgttgcagg cctggctgga 120 aaagacccag tacagtgtag ccgtgatgtg gtcatttgtc ctgatgccag ccttgaagat 180 gcaaaaaaag agggaccata tgatgtggtg gttctaccag gaggtaatct gggcgcacag 240 aatttatctg agtctgctgc tgtgaaggag atactgaagg agcaggaaaa ccggaagggc 300 ctgatagccg ccatctgtgc aggtcctact gctctgttgg ctcatgaaat aggctgtgga 360 agtaaagtta caacacaccc tcttgctaaa gacaaaatga tgaatggagg tcattacacc 420 tactctgaga atcgtgtgga aaaagacggc ctgattctta caagccgggg gcctgggacc 480 agcttcgagt ttgcgcttgc aattgttgaa gccctgaatg gcaaggaggt ggcggctcaa 540 gtgaaggctc cacttgttct taaagactag 570 //