NC_004952 3990 double DNA circular CON 24-FEB-2025 07-JUL-2003 Francisella tularensis subsp. novicida F6168 plasmid pFNL10, complete sequence NC_004952 NC_004952.1 ref|NC_004952.1| gi|32455353 PRJNA224116 RefSeq Francisella tularensis subsp. novicida F6168 Francisella tularensis subsp. novicida F6168 Bacteria; Pseudomonadati; Pseudomonadota; Gammaproteobacteria; Thiotrichales; Francisellaceae; Francisella 1 1..3990 Pomerantsev,A.P. Golovliov,I.R. Ohara,Y. Mokrievich,A.N. Obuchi,M. Norqvist,A. Kuoppa,K. Pavlov,V.M. Genetic organization of the Francisella plasmid pFNL10 Plasmid 46 (3), 210-222 (2001) doi 10.1006/plas.2001.1548 11735370 2 1..3990 Pomerantsev,A.P. Golovliov,I.R. Mokrievish,A.N. Pavlov,V.M. Direct Submission Submitted (20-JAN-1999) Microbiology, State Research Center for Applied Microbiology, Obolensk, Moscow Region 142279, Russia REFSEQ INFORMATION: The reference sequence is identical to AF121418.1.; The annotation was added by the NCBI Prokaryotic Genome Annotation Pipeline (PGAP). Information about PGAP can be found here: https://www.ncbi.nlm.nih.gov/genome/annotation_prok/; ##Genome-Annotation-Data-START## ; Annotation Provider :: NCBI RefSeq ; Annotation Name :: GCF_009942045.2-RS_2025_02_24 ; Annotation Date :: 02/24/2025 01:40:53 ; Annotation Pipeline :: NCBI Prokaryotic Genome Annotation Pipeline (PGAP) ; Annotation Method :: Best-placed reference protein set; GeneMarkS-2+ ; Annotation Software revision :: 6.9 ; Features Annotated :: Gene; CDS; rRNA; tRNA; ncRNA ; Genes (total) :: 6 ; CDSs (total) :: 6 ; Genes (coding) :: 5 ; CDSs (with protein) :: 5 ; Genes (RNA) :: 0 ; tRNAs :: 0 ; ncRNAs :: 0 ; Pseudo Genes (total) :: 1 ; CDSs (without protein) :: 1 ; Pseudo Genes (ambiguous residues) :: 0 of 1 ; Pseudo Genes (frameshifted) :: 1 of 1 ; Pseudo Genes (incomplete) :: 0 of 1 ; Pseudo Genes (internal stop) :: 0 of 1 ; ##Genome-Annotation-Data-END##; COMPLETENESS: full length. source 1..3990 1 3990 NC_004952.1 organism Francisella tularensis subsp. novicida F6168 mol_type genomic DNA strain F6168 sub_species novicida db_xref taxon:1452728 plasmid pFNL10 gene complement(join(3934..3990,1..135)) 135 1 NC_004952.1 3990 3934 NC_004952.1 join locus_tag HKJ39_RS00005 CDS complement(join(3934..3990,1..135)) 135 1 NC_004952.1 3990 3934 NC_004952.1 join locus_tag HKJ39_RS00005 inference COORDINATES: ab initio prediction:GeneMarkS-2+ note Derived by automated computational analysis using gene prediction method: GeneMarkS-2+. codon_start 1 transl_table 11 product hypothetical protein protein_id WP_042536701.1 translation MNDFKKENRFLDLVKQQDDKFDDLTSKIDDLSKNIKSLRRVDLLCKIAFFSSIAILLFICLSS gene complement(180..602) 602 180 NC_004952.1 locus_tag HKJ39_RS00010 old_locus_tag pFNL10_p1 CDS complement(180..602) 602 180 NC_004952.1 locus_tag HKJ39_RS00010 old_locus_tag pFNL10_p1 inference COORDINATES: ab initio prediction:GeneMarkS-2+ note Derived by automated computational analysis using gene prediction method: GeneMarkS-2+. codon_start 1 transl_table 11 product hypothetical protein protein_id WP_010891134.1 translation MNIEIFKFSKKHKKINKKLIDLTKVKQVVTTGYSFIVVYQRGRKIELSYESSYWHAKKDLDNSNSDVGITYSYIKKDKRGPCHKDNYLRDSKGRLLKDWGKIEELHEKYPKIGKIWYISREETDKLLKDFTYKNGNLIMV gene complement(605..1624) 1624 605 NC_004952.1 locus_tag HKJ39_RS00015 old_locus_tag pFNL10_p2 CDS complement(605..1624) 1624 605 NC_004952.1 locus_tag HKJ39_RS00015 old_locus_tag pFNL10_p2 inference COORDINATES: protein motif:HMM:NF013235.5 GO_function GO:0003887 - DNA-directed DNA polymerase activity [Evidence IEA] GO_process GO:0006270 - DNA replication initiation [Evidence IEA] note Derived by automated computational analysis using gene prediction method: Protein Homology. codon_start 1 transl_table 11 product replication initiation protein protein_id WP_010891135.1 translation MKEVKNVNAGKEIAMSNTLVAGKYSLTKEEQNLIFLVASMVKREDKEFHRYKISLSDLEKATGVKHNRVRLKQLMHSIMSKPVWLNKEQTKIANWFAYIEADPKSSALICEFHWSLMPHMIQLQEYFTKAERQLLFSFKSKYSSRLYLLLKSKLGEQAGYANIVDCVLYVDDMINDFDLPKSYSNRYSNFKNKFLLPALEEINQLSDIFVTYDDKDHHRKHGRKITNIKFTVSKVAETEEEFKQKLLDTKNKEDYIPIEASERLREVVLSDELDLDLYYVRSIFRHHHLHDIERVCDDTWRNWDNKKIKDRKRVFIANIKKLEKKPEENHKLPFGFEEV gene 1995..2252 1995 2252 NC_004952.1 locus_tag HKJ39_RS00020 old_locus_tag pFNL10_p3 CDS 1995..2252 1995 2252 NC_004952.1 locus_tag HKJ39_RS00020 old_locus_tag pFNL10_p3 inference COORDINATES: similar to AA sequence:RefSeq:WP_020292155.1 GO_component GO:0110001 - toxin-antitoxin complex [Evidence IEA] GO_function GO:0003677 - DNA binding [Evidence IEA]; GO:0097351 - toxin sequestering activity [Evidence IEA] GO_process GO:0045927 - positive regulation of growth [Evidence IEA]; GO:0006355 - regulation of DNA-templated transcription [Evidence IEA] note Derived by automated computational analysis using gene prediction method: Protein Homology. codon_start 1 transl_table 11 product type II toxin-antitoxin system Phd/YefM family antitoxin protein_id WP_011117071.1 translation MQTVNYSTFRNELSDSMDRVTKNHSPMIVTRGSKKEAVVMMSLEDFKAYEETAYLMRSMNNYKRLQNSIDEVESGLAIQKELIEE gene 2249..2516 2249 2516 NC_004952.1 locus_tag HKJ39_RS00025 old_locus_tag pFNL10_p4 pseudo CDS 2249..2516 2249 2516 NC_004952.1 locus_tag HKJ39_RS00025 old_locus_tag pFNL10_p4 inference COORDINATES: similar to AA sequence:RefSeq:WP_005556313.1 GO_process GO:0008219 - cell death [Evidence IEA] note frameshifted; Derived by automated computational analysis using gene prediction method: Protein Homology. pseudo codon_start 1 transl_table 11 product Txe/YoeB family addiction module toxin gene 3075..3953 3075 3953 NC_004952.1 locus_tag HKJ39_RS00030 old_locus_tag pFNL10_p6 CDS 3075..3953 3075 3953 NC_004952.1 locus_tag HKJ39_RS00030 old_locus_tag pFNL10_p6 inference COORDINATES: similar to AA sequence:RefSeq:WP_017040200.1 note Derived by automated computational analysis using gene prediction method: Protein Homology. codon_start 1 transl_table 11 product integrase domain-containing protein protein_id WP_011117073.1 translation MKDKAAKNRDFRKTILSVLQRNKDGSFATQANRKSILLQATKDLKKVGFSKVTAENFGNKHCYALRDHWRAQGLATATIKNRLACLRWLGEKMGKELPDNRKLEIENRKYSDNSINKAQEIDFKAISALTDRQALAIQLQREFGLRREESLKFQPSYAIKEHKIELKSSWTKVGRPREIPILNEKQRELLEKVKEVAGKGSLIESEKSYKQAMEHFTTRCQRAGIKNVHGFRHAYAQDRYRQLTGRECPKNGGLTSKQLTPEQKQQDYEARMTISEELGHGREDVTVNYLGR join(AF121418.1:1..3990) BioProject PRJNA224116 BioSample SAMN14224658