Dbfetch

Dbfetch

LOCUS       XM_012208308             567 bp    mRNA    linear   INV 02-APR-2015
DEFINITION  PREDICTED: Atta cephalotes uncharacterized LOC105627029
            (LOC105627029), mRNA.
ACCESSION   XM_012208308
VERSION     XM_012208308.1
DBLINK      BioProject: PRJNA279976
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Atta cephalotes
  ORGANISM  Atta cephalotes
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita;
            Aculeata; Formicoidea; Formicidae; Myrmicinae; Atta.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_012130071.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Atta cephalotes Annotation Release
                                           100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 50% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..567
                     /organism="Atta cephalotes"
                     /mol_type="mRNA"
                     /db_xref="taxon:12957"
                     /chromosome="Unknown"
                     /sex="male"
     gene            1..567
                     /gene="LOC105627029"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein"
                     /db_xref="GeneID:105627029"
     CDS             1..567
                     /gene="LOC105627029"
                     /codon_start=1
                     /product="uncharacterized protein LOC105627029"
                     /protein_id="XP_012063698.1"
                     /db_xref="GeneID:105627029"
                     /translation="MVNDTRPLCVSILMSNIKRSLLIELKALKKRHLMLTSIIYYVTQ
                     MMLLVWICETGKNQAQQIRTTIHDLLNNTSDKQIKNEYVTYFFIKILLIVWACETGKA
                     QAQQISISIHDVFNVTTDKKIKDELQIFSLQVLHCDNIFSAKCFTIDAKLLTAVVGSV
                     SMYLIILFQFKNISNSCVEKTTNSTGEI"
ORIGIN      
        1 atggtaaacg atacaagacc attatgtgtt tccatattga tgagcaacat aaagagaagt
       61 ttgctaatag aactaaaggc cctgaagaag cgacatctga tgcttacatc cataatatat
      121 tacgttacac aaatgatgct acttgtatgg atctgcgaaa ccggaaaaaa tcaggctcaa
      181 cagattcgta ccactattca cgatctactt aacaacacta gtgataaaca aattaaaaac
      241 gagtacgtga catacttctt cataaaaata ctattgatag tatgggcttg tgaaacgggt
      301 aaagctcaag ctcaacaaat cagcatttcc attcatgatg tatttaacgt taccaccgat
      361 aagaaaatca aagatgagtt acaaatattt tctttacaag tacttcattg cgataatata
      421 ttttctgcaa aatgttttac tatagacgcg aagcttctta ctgcggtagt aggtagcgtc
      481 agcatgtacc taataatatt atttcaattc aagaatatat caaattcttg tgtagaaaag
      541 acgacaaata gtacaggaga aatctaa
//