Dbfetch
LOCUS NM_001021862 1046 bp mRNA linear PLN 16-AUG-2024 DEFINITION Schizosaccharomyces pombe cyclin CycC-like Srb mediator subunit Srb11 (srb11), mRNA. ACCESSION NM_001021862 VERSION NM_001021862.3 DBLINK BioProject: PRJNA127 BioSample: SAMEA3138176 KEYWORDS RefSeq. SOURCE Schizosaccharomyces pombe (fission yeast) ORGANISM Schizosaccharomyces pombe Eukaryota; Fungi; Dikarya; Ascomycota; Taphrinomycotina; Schizosaccharomycetes; Schizosaccharomycetales; Schizosaccharomycetaceae; Schizosaccharomyces. REFERENCE 1 (bases 1 to 1046) AUTHORS Schafer,B., Hansen,M. and Lang,B.F. TITLE Transcription and RNA-processing in fission yeast mitochondria JOURNAL RNA 11 (5), 785-795 (2005) PUBMED 15811919 REFERENCE 2 (bases 1 to 1046) AUTHORS Wood,V., Gwilliam,R., Rajandream,M.A., Lyne,M., Lyne,R., Stewart,A., Sgouros,J., Peat,N., Hayles,J., Baker,S., Basham,D., Bowman,S., Brooks,K., Brown,D., Brown,S., Chillingworth,T., Churcher,C., Collins,M., Connor,R., Cronin,A., Davis,P., Feltwell,T., Fraser,A., Gentles,S., Goble,A., Hamlin,N., Harris,D., Hidalgo,J., Hodgson,G., Holroyd,S., Hornsby,T., Howarth,S., Huckle,E.J., Hunt,S., Jagels,K., James,K., Jones,L., Jones,M., Leather,S., McDonald,S., McLean,J., Mooney,P., Moule,S., Mungall,K., Murphy,L., Niblett,D., Odell,C., Oliver,K., O'Neil,S., Pearson,D., Quail,M.A., Rabbinowitsch,E., Rutherford,K., Rutter,S., Saunders,D., Seeger,K., Sharp,S., Skelton,J., Simmonds,M., Squares,R., Squares,S., Stevens,K., Taylor,K., Taylor,R.G., Tivey,A., Walsh,S., Warren,T., Whitehead,S., Woodward,J., Volckaert,G., Aert,R., Robben,J., Grymonprez,B., Weltjens,I., Vanstreels,E., Rieger,M., Schafer,M., Muller-Auer,S., Gabel,C., Fuchs,M., Dusterhoft,A., Fritzc,C., Holzer,E., Moestl,D., Hilbert,H., Borzym,K., Langer,I., Beck,A., Lehrach,H., Reinhardt,R., Pohl,T.M., Eger,P., Zimmermann,W., Wedler,H., Wambutt,R., Purnelle,B., Goffeau,A., Cadieu,E., Dreano,S., Gloux,S., Lelaure,V., Mottier,S., Galibert,F., Aves,S.J., Xiang,Z., Hunt,C., Moore,K., Hurst,S.M., Lucas,M., Rochet,M., Gaillardin,C., Tallada,V.A., Garzon,A., Thode,G., Daga,R.R., Cruzado,L., Jimenez,J., Sanchez,M., del Rey,F., Benito,J., Dominguez,A., Revuelta,J.L., Moreno,S., Armstrong,J., Forsburg,S.L., Cerutti,L., Lowe,T., McCombie,W.R., Paulsen,I., Potashkin,J., Shpakovski,G.V., Ussery,D., Barrell,B.G. and Nurse,P. TITLE The genome sequence of Schizosaccharomyces pombe JOURNAL Nature 415 (6874), 871-880 (2002) PUBMED 11859360 REMARK Erratum:[Nature 2003 Jan 2;421(6918):94. Cerrutti L [corrected to Cerutti L]] REFERENCE 3 AUTHORS Wood,V., Gwilliam,R., Rajandream,M.A., Lyne,M., Lyne,R., Stewart,A., Sgouros,J., Peat,N., Hayles,J., Baker,S., Basham,D., Bowman,S., Brooks,K., Brown,D., Brown,S., Chillingworth,T., Churcher,C., Collins,M., Connor,R., Cronin,A., Davis,P., Feltwell,T., Fraser,A., Gentles,S., Goble,A., Hamlin,N., Harris,D., Hidalgo,J., Hodgson,G., Holroyd,S., Hornsby,T., Howarth,S., Huckle,E.J., Hunt,S., Jagels,K., James,K., Jones,L., Jones,M., Leather,S., McDonald,S., McLean,J., Mooney,P., Moule,S., Mungall,K., Murphy,L., Niblett,D., Odell,C., Oliver,K., O'Neil,S., Pearson,D., Quail,M.A., Rabbinowitsch,E., Rutherford,K., Rutter,S., Saunders,D., Seeger,K., Sharp,S., Skelton,J., Simmonds,M., Squares,R., Squares,S., Stevens,K., Taylor,K., Taylor,R.G., Tivey,A., Walsh,S., Warren,T., Whitehead,S., Woodward,J., Volckaert,G., Aert,R., Robben,J., Grymonprez,B., Weltjens,I., Vanstreels,E., Rieger,M., Schafer,M., Muller-Auer,S., Gabel,C., Fuchs,M., Dusterhoft,A., Fritzc,C., Holzer,E., Moestl,D., Hilbert,H., Borzym,K., Langer,I., Beck,A., Lehrach,H., Reinhardt,R., Pohl,T.M., Eger,P., Zimmermann,W., Wedler,H., Wambutt,R., Purnelle,B., Goffeau,A., Cadieu,E., Dreano,S., Gloux,S., Lelaure,V., Mottier,S., Galibert,F., Aves,S.J., Xiang,Z., Hunt,C., Moore,K., Hurst,S.M., Lucas,M., Rochet,M., Gaillardin,C., Tallada,V.A., Garzon,A., Thode,G., Daga,R.R., Cruzado,L., Jimenez,J., Sanchez,M., del Rey,F., Benito,J., Dominguez,A., Revuelta,J.L., Moreno,S., Armstrong,J., Forsburg,S.L., Cerutti,L., Lowe,T., McCombie,W.R., Paulsen,I., Potashkin,J., Shpakovski,G.V., Ussery,D., Barrell,B.G. and Nurse,P. TITLE The genome sequence of Schizosaccharomyces pombe JOURNAL Nature 415 (6874), 871-880 (2002) PUBMED 11859360 REMARK Erratum:[Nature 2003 Jan 2;421(6918):94. Cerrutti L [corrected to Cerutti L]] REFERENCE 4 (bases 1 to 1046) AUTHORS Trinkl,H., Lang,B.F. and Wolf,K. TITLE Nucleotide sequence of the gene encoding the small ribosomal RNA in the mitochondrial genome of the fission yeast Schizosaccharomyces pombe JOURNAL Nucleic Acids Res 17 (16), 6730 (1989) PUBMED 2780299 REFERENCE 5 (bases 1 to 1046) AUTHORS Lang,B.F., Cedergren,R. and Gray,M.W. TITLE The mitochondrial genome of the fission yeast, Schizosaccharomyces pombe. Sequence of the large-subunit ribosomal RNA gene, comparison of potential secondary structure in fungal mitochondrial large-subunit rRNAs and evolutionary considerations JOURNAL Eur J Biochem 169 (3), 527-537 (1987) PUBMED 2446871 REFERENCE 6 (bases 1 to 1046) AUTHORS Lang,B.F., Ahne,F. and Bonen,L. TITLE The mitochondrial genome of the fission yeast Schizosaccharomyces pombe. The cytochrome b gene has an intron closely related to the first two introns in the Saccharomyces cerevisiae cox1 gene JOURNAL J Mol Biol 184 (3), 353-366 (1985) PUBMED 4046021 REFERENCE 7 (bases 1 to 1046) AUTHORS Lang,B.F. TITLE The mitochondrial genome of the fission yeast Schizosaccharomyces pombe: highly homologous introns are inserted at the same position of the otherwise less conserved cox1 genes in Schizosaccharomyces pombe and Aspergillus nidulans JOURNAL EMBO J 3 (9), 2129-2136 (1984) PUBMED 6092057 REFERENCE 8 (bases 1 to 1046) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (16-AUG-2024) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 9 AUTHORS Wood,V. and Rutherford,K. CONSRTM PomBase TITLE Direct Submission JOURNAL Submitted (13-MAR-2024) University of Cambridge, PomBase, Hopkins building, Tennis Court Rd, Cambridge, United Kingdom REFERENCE 10 AUTHORS Wood,V. CONSRTM The Schizosaccharomyces pombe Genome Sequencing Consortium TITLE Direct Submission JOURNAL Submitted (29-JUN-2007) European Schizosaccharomyces genome sequencing project, Sanger Institute, The Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 1SA COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_003423). On Jun 21, 2024 this sequence version replaced NM_001021862.2. FEATURES Location/Qualifiers source 1..1046 /organism="Schizosaccharomyces pombe" /mol_type="mRNA" /strain="972h-" /db_xref="taxon:4896" /chromosome="II" gene 1..1046 /gene="srb11" /locus_tag="SPOM_SPBC12D12.06" /db_xref="GeneID:2539651" /db_xref="PomBase:SPBC12D12.06" CDS 114..800 /gene="srb11" /locus_tag="SPOM_SPBC12D12.06" /codon_start=1 /product="cyclin CycC-like Srb mediator subunit Srb11" /protein_id="NP_595953.1" /db_xref="GeneID:2539651" /db_xref="PomBase:SPBC12D12.06" /translation="MAANYWASSQLTQLFLSTDLESLEPTCLSKDTIYQWKVVQTFGD RLRLRQRVLATAIVLLRRYMLKKNEEKGFSLEALVATCIYLSCKVEECPVHIRTICNE ANDLWSLKVKLSRSNISEIEFEIISVLDAFLIVHHPYTSLEQAFHDGIINQKQLEFAW SIVNDSYASSLCLMAHPHQLAYAALLISCCNDENTIPKLLDLIKSTDAFKVILCVQRI ISIYYFEDIE" ORIGIN 1 gaccatacca gcagcccatg aaaatttatc gtaaatagta aaatctgtga cactgttttt 61 tattatctct tatgatattt aagggtcaat cagcttaaaa tatcgtgtga tatatggcag 121 caaattactg ggcctctagt caattaacac aattattctt atccacagat ttggaatctt 181 tggaaccaac ttgcttatct aaagatacaa tatatcaatg gaaagttgta caaacgtttg 241 gagacaggct caggcttcgg cagcgtgtct tagctacagc catcgtttta ttaaggcgtt 301 acatgctaaa aaaaaatgag gaaaagggtt tttctttgga ggcgctagtg gctacatgca 361 tttatttatc atgcaaagtg gaagaatgcc ctgttcacat tcgcacaatt tgcaatgagg 421 ctaatgatct ctggagccta aaagttaaac ttagtcgttc taatatttcc gaaatagaat 481 ttgaaatcat ttcagtcctt gatgcatttc tcattgttca ccatccctac acttctcttg 541 agcaagcatt tcatgatggc attatcaatc aaaagcagct tgagtttgct tggagcattg 601 ttaacgattc atatgccagc agtttatgtt taatggcaca tcctcatcaa cttgcgtatg 661 ccgctttatt aataagttgt tgcaatgatg aaaatacaat tcctaagctt ttggatttaa 721 taaagagtac tgatgccttc aaagttatat tatgtgttca acgcataatt tctatttatt 781 attttgagga tattgaataa cttcttgaat acactataca tttagagcct caaattttgt 841 taaaaacgaa aactataatt agatttttct ttattgctga ttaatgcctg aaattatgtt 901 ttgttgtctg gtttaaaacc gtgtattata tacgcattct cgttcatggt gttatgtcta 961 aatgaataaa tagagcagta tctgtgtaat aatatccaaa atcgaatggt tatgtcacaa 1021 acgtaaagga tatattaatg ctttat //