Dbfetch
LOCUS NM_001018203 1851 bp mRNA linear PLN 16-AUG-2024 DEFINITION Schizosaccharomyces pombe MatE family transporter (SPOM_SPAC11D3.06), mRNA. ACCESSION NM_001018203 VERSION NM_001018203.3 DBLINK BioProject: PRJNA127 BioSample: SAMEA3138176 KEYWORDS RefSeq. SOURCE Schizosaccharomyces pombe (fission yeast) ORGANISM Schizosaccharomyces pombe Eukaryota; Fungi; Dikarya; Ascomycota; Taphrinomycotina; Schizosaccharomycetes; Schizosaccharomycetales; Schizosaccharomycetaceae; Schizosaccharomyces. REFERENCE 1 (bases 1 to 1851) AUTHORS Schafer,B., Hansen,M. and Lang,B.F. TITLE Transcription and RNA-processing in fission yeast mitochondria JOURNAL RNA 11 (5), 785-795 (2005) PUBMED 15811919 REFERENCE 2 (bases 1 to 1851) AUTHORS Wood,V., Gwilliam,R., Rajandream,M.A., Lyne,M., Lyne,R., Stewart,A., Sgouros,J., Peat,N., Hayles,J., Baker,S., Basham,D., Bowman,S., Brooks,K., Brown,D., Brown,S., Chillingworth,T., Churcher,C., Collins,M., Connor,R., Cronin,A., Davis,P., Feltwell,T., Fraser,A., Gentles,S., Goble,A., Hamlin,N., Harris,D., Hidalgo,J., Hodgson,G., Holroyd,S., Hornsby,T., Howarth,S., Huckle,E.J., Hunt,S., Jagels,K., James,K., Jones,L., Jones,M., Leather,S., McDonald,S., McLean,J., Mooney,P., Moule,S., Mungall,K., Murphy,L., Niblett,D., Odell,C., Oliver,K., O'Neil,S., Pearson,D., Quail,M.A., Rabbinowitsch,E., Rutherford,K., Rutter,S., Saunders,D., Seeger,K., Sharp,S., Skelton,J., Simmonds,M., Squares,R., Squares,S., Stevens,K., Taylor,K., Taylor,R.G., Tivey,A., Walsh,S., Warren,T., Whitehead,S., Woodward,J., Volckaert,G., Aert,R., Robben,J., Grymonprez,B., Weltjens,I., Vanstreels,E., Rieger,M., Schafer,M., Muller-Auer,S., Gabel,C., Fuchs,M., Dusterhoft,A., Fritzc,C., Holzer,E., Moestl,D., Hilbert,H., Borzym,K., Langer,I., Beck,A., Lehrach,H., Reinhardt,R., Pohl,T.M., Eger,P., Zimmermann,W., Wedler,H., Wambutt,R., Purnelle,B., Goffeau,A., Cadieu,E., Dreano,S., Gloux,S., Lelaure,V., Mottier,S., Galibert,F., Aves,S.J., Xiang,Z., Hunt,C., Moore,K., Hurst,S.M., Lucas,M., Rochet,M., Gaillardin,C., Tallada,V.A., Garzon,A., Thode,G., Daga,R.R., Cruzado,L., Jimenez,J., Sanchez,M., del Rey,F., Benito,J., Dominguez,A., Revuelta,J.L., Moreno,S., Armstrong,J., Forsburg,S.L., Cerutti,L., Lowe,T., McCombie,W.R., Paulsen,I., Potashkin,J., Shpakovski,G.V., Ussery,D., Barrell,B.G. and Nurse,P. TITLE The genome sequence of Schizosaccharomyces pombe JOURNAL Nature 415 (6874), 871-880 (2002) PUBMED 11859360 REMARK Erratum:[Nature 2003 Jan 2;421(6918):94. Cerrutti L [corrected to Cerutti L]] REFERENCE 3 AUTHORS Wood,V., Gwilliam,R., Rajandream,M.A., Lyne,M., Lyne,R., Stewart,A., Sgouros,J., Peat,N., Hayles,J., Baker,S., Basham,D., Bowman,S., Brooks,K., Brown,D., Brown,S., Chillingworth,T., Churcher,C., Collins,M., Connor,R., Cronin,A., Davis,P., Feltwell,T., Fraser,A., Gentles,S., Goble,A., Hamlin,N., Harris,D., Hidalgo,J., Hodgson,G., Holroyd,S., Hornsby,T., Howarth,S., Huckle,E.J., Hunt,S., Jagels,K., James,K., Jones,L., Jones,M., Leather,S., McDonald,S., McLean,J., Mooney,P., Moule,S., Mungall,K., Murphy,L., Niblett,D., Odell,C., Oliver,K., O'Neil,S., Pearson,D., Quail,M.A., Rabbinowitsch,E., Rutherford,K., Rutter,S., Saunders,D., Seeger,K., Sharp,S., Skelton,J., Simmonds,M., Squares,R., Squares,S., Stevens,K., Taylor,K., Taylor,R.G., Tivey,A., Walsh,S., Warren,T., Whitehead,S., Woodward,J., Volckaert,G., Aert,R., Robben,J., Grymonprez,B., Weltjens,I., Vanstreels,E., Rieger,M., Schafer,M., Muller-Auer,S., Gabel,C., Fuchs,M., Dusterhoft,A., Fritzc,C., Holzer,E., Moestl,D., Hilbert,H., Borzym,K., Langer,I., Beck,A., Lehrach,H., Reinhardt,R., Pohl,T.M., Eger,P., Zimmermann,W., Wedler,H., Wambutt,R., Purnelle,B., Goffeau,A., Cadieu,E., Dreano,S., Gloux,S., Lelaure,V., Mottier,S., Galibert,F., Aves,S.J., Xiang,Z., Hunt,C., Moore,K., Hurst,S.M., Lucas,M., Rochet,M., Gaillardin,C., Tallada,V.A., Garzon,A., Thode,G., Daga,R.R., Cruzado,L., Jimenez,J., Sanchez,M., del Rey,F., Benito,J., Dominguez,A., Revuelta,J.L., Moreno,S., Armstrong,J., Forsburg,S.L., Cerutti,L., Lowe,T., McCombie,W.R., Paulsen,I., Potashkin,J., Shpakovski,G.V., Ussery,D., Barrell,B.G. and Nurse,P. TITLE The genome sequence of Schizosaccharomyces pombe JOURNAL Nature 415 (6874), 871-880 (2002) PUBMED 11859360 REMARK Erratum:[Nature 2003 Jan 2;421(6918):94. Cerrutti L [corrected to Cerutti L]] REFERENCE 4 (bases 1 to 1851) AUTHORS Trinkl,H., Lang,B.F. and Wolf,K. TITLE Nucleotide sequence of the gene encoding the small ribosomal RNA in the mitochondrial genome of the fission yeast Schizosaccharomyces pombe JOURNAL Nucleic Acids Res 17 (16), 6730 (1989) PUBMED 2780299 REFERENCE 5 (bases 1 to 1851) AUTHORS Lang,B.F., Cedergren,R. and Gray,M.W. TITLE The mitochondrial genome of the fission yeast, Schizosaccharomyces pombe. Sequence of the large-subunit ribosomal RNA gene, comparison of potential secondary structure in fungal mitochondrial large-subunit rRNAs and evolutionary considerations JOURNAL Eur J Biochem 169 (3), 527-537 (1987) PUBMED 2446871 REFERENCE 6 (bases 1 to 1851) AUTHORS Lang,B.F., Ahne,F. and Bonen,L. TITLE The mitochondrial genome of the fission yeast Schizosaccharomyces pombe. The cytochrome b gene has an intron closely related to the first two introns in the Saccharomyces cerevisiae cox1 gene JOURNAL J Mol Biol 184 (3), 353-366 (1985) PUBMED 4046021 REFERENCE 7 (bases 1 to 1851) AUTHORS Lang,B.F. TITLE The mitochondrial genome of the fission yeast Schizosaccharomyces pombe: highly homologous introns are inserted at the same position of the otherwise less conserved cox1 genes in Schizosaccharomyces pombe and Aspergillus nidulans JOURNAL EMBO J 3 (9), 2129-2136 (1984) PUBMED 6092057 REFERENCE 8 (bases 1 to 1851) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (16-AUG-2024) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 9 AUTHORS Wood,V. and Rutherford,K. CONSRTM PomBase TITLE Direct Submission JOURNAL Submitted (13-MAR-2024) University of Cambridge, PomBase, Hopkins building, Tennis Court Rd, Cambridge, United Kingdom REFERENCE 10 AUTHORS Wood,V. CONSRTM The Schizosaccharomyces pombe Genome Sequencing Consortium TITLE Direct Submission JOURNAL Submitted (29-JUN-2007) European Schizosaccharomyces genome sequencing project, Sanger Institute, The Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 1SA COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_003424). On Jun 21, 2024 this sequence version replaced NM_001018203.2. FEATURES Location/Qualifiers source 1..1851 /organism="Schizosaccharomyces pombe" /mol_type="mRNA" /strain="972h-" /db_xref="taxon:4896" /chromosome="I" gene 1..1851 /locus_tag="SPOM_SPAC11D3.06" /db_xref="GeneID:2542994" /db_xref="PomBase:SPAC11D3.06" CDS 355..1722 /locus_tag="SPOM_SPAC11D3.06" /codon_start=1 /product="MatE family transporter" /protein_id="NP_592803.1" /db_xref="GeneID:2542994" /db_xref="PomBase:SPAC11D3.06" /translation="MGRPLTEVKYLLINSAPVILGYALQNSLQTSSVIVTGRLGPSEL SVAAFAYMFAMSTGWLIALGGTTAFDTLGSNLWGAGKKQELGILLQTGFIVLSILYLP ICLVWWYSKPILIFLHQTPELAEASQKFLRYLIPGGLGYVCFELLKKFLQTQEITRAG SYILLVTSPLNVALNFLLVHYYGLGLKGAPLATGLSYWLSFILLTQYAKYVKGAEAWN GWNKRCLENFGPFVKLSLLGIVMVGTEWWAFEIVALVAGKLGAVPLAAQSVIMTTDQL LNTIPFGLGIITSNRVAYYLGAGLPDNASLTAKVAAIVGVAVGSVIMITMIAVRNIYG RIFTNDPDVIQLVALVMPLVAAFQISDSLNGTMGGALRGTGRQKVGAIVNITAYYLFA LPLGIYLAFHGKGLVGLWIGQVIALSIVGILELKIVMATDWISQSRKAISRFGDSSEL TALLN" ORIGIN 1 accggcaaaa tatgctaact gctatcattt aagttagcaa aaactcggcg agaattccca 61 atgtctgttg gctaagcgaa aaatattttg cgtgggtatt tctaaatttc cgtatctcca 121 cggatatact aatgtttagc catgacatct gaagttttat gccctaaatg tgcggcttct 181 aagcgttctc tgatataaat ttatggttcc atccgttcaa tcaatatgat aaaagcttag 241 taaactttta ttaaaggaaa atttgaacct tcggtgaaca gacattaaga agtactcttt 301 atttatatta aaaaatacac cgtatatcca aattttctct gagaaagcac tattatgggt 361 agaccactta cagaggtgaa ataccttttg ataaattcag ctccggtaat ccttggatat 421 gccttgcaaa actctttgca aactagttca gttattgtaa ccgggcgcct tggaccaagc 481 gagctttccg tagctgcttt tgcgtacatg tttgcgatga gcacaggctg gctgattgct 541 ctaggtggaa ctactgcttt tgacacactt ggctccaacc tttggggagc cggaaaaaaa 601 caagaattgg gaattctatt gcaaacgggt ttcatcgtgc tcagtattct atatctgcca 661 atatgtttag tttggtggta ttctaaaccc atcctaattt tcttgcatca aacacctgaa 721 ttagctgaag cttcacaaaa gtttttacga taccttatcc caggcggact aggttatgta 781 tgttttgaat tgctaaaaaa gtttttgcaa acacaagaaa tcactagggc tggttcttat 841 attcttctag ttacctctcc tcttaatgtc gccttaaatt ttctacttgt ccattattat 901 ggattaggtt taaaaggcgc tccattggca actggattat cgtactggct ttcattcatt 961 ttattaactc aatatgcgaa atacgtaaaa ggggcagagg cgtggaatgg ttggaataaa 1021 cgatgcttag agaactttgg accttttgta aagttatcac tattgggtat cgttatggtg 1081 ggaacagaat ggtgggcttt tgaaatagta gcactagttg ctggtaaact tggtgctgta 1141 ccacttgccg ctcaatcagt aattatgacc acagatcaat tacttaacac aattcctttc 1201 ggtctcggaa taattacttc taatcgagtt gcctactatc tcggagctgg gttacctgac 1261 aatgcttctc taactgctaa ggtcgcagca attgtaggtg ttgcagtagg aagcgttatc 1321 atgattacca tgattgccgt acgcaatatc tatggacgga ttttcacaaa tgatccagat 1381 gtcattcagc tggttgctct tgtaatgccc ttagtagctg ctttccaaat atcagattcc 1441 ttgaatggta caatgggagg agctttaaga ggcacgggaa gacagaaggt tggcgctata 1501 gttaacatta ctgcctacta tttgtttgct ctgcctctag gaatttattt agccttccat 1561 ggcaaaggtc ttgtcggtct ttggattgga caggtaatag cgttatccat agtcggaatt 1621 ttagaactga aaattgtaat ggcaactgac tggatttccc aatcaagaaa ggcaatctca 1681 agatttggtg actcctctga attgactgca ctactcaatt agacatttgg gtcgatgcat 1741 gtagttgatc aagcaaaata gtttgataat agcttcattg ttaaccggta atgatgttca 1801 ccatgtacat taaagcaaat aaattattaa taaaacaacg ttactttcat a //