Dbfetch

LOCUS       NM_001018203            1851 bp    mRNA    linear   PLN 16-AUG-2024
DEFINITION  Schizosaccharomyces pombe MatE family transporter
            (SPOM_SPAC11D3.06), mRNA.
ACCESSION   NM_001018203
VERSION     NM_001018203.3
DBLINK      BioProject: PRJNA127
            BioSample: SAMEA3138176
KEYWORDS    RefSeq.
SOURCE      Schizosaccharomyces pombe (fission yeast)
  ORGANISM  Schizosaccharomyces pombe
            Eukaryota; Fungi; Dikarya; Ascomycota; Taphrinomycotina;
            Schizosaccharomycetes; Schizosaccharomycetales;
            Schizosaccharomycetaceae; Schizosaccharomyces.
REFERENCE   1  (bases 1 to 1851)
  AUTHORS   Schafer,B., Hansen,M. and Lang,B.F.
  TITLE     Transcription and RNA-processing in fission yeast mitochondria
  JOURNAL   RNA 11 (5), 785-795 (2005)
   PUBMED   15811919
REFERENCE   2  (bases 1 to 1851)
  AUTHORS   Wood,V., Gwilliam,R., Rajandream,M.A., Lyne,M., Lyne,R.,
            Stewart,A., Sgouros,J., Peat,N., Hayles,J., Baker,S., Basham,D.,
            Bowman,S., Brooks,K., Brown,D., Brown,S., Chillingworth,T.,
            Churcher,C., Collins,M., Connor,R., Cronin,A., Davis,P.,
            Feltwell,T., Fraser,A., Gentles,S., Goble,A., Hamlin,N., Harris,D.,
            Hidalgo,J., Hodgson,G., Holroyd,S., Hornsby,T., Howarth,S.,
            Huckle,E.J., Hunt,S., Jagels,K., James,K., Jones,L., Jones,M.,
            Leather,S., McDonald,S., McLean,J., Mooney,P., Moule,S.,
            Mungall,K., Murphy,L., Niblett,D., Odell,C., Oliver,K., O'Neil,S.,
            Pearson,D., Quail,M.A., Rabbinowitsch,E., Rutherford,K., Rutter,S.,
            Saunders,D., Seeger,K., Sharp,S., Skelton,J., Simmonds,M.,
            Squares,R., Squares,S., Stevens,K., Taylor,K., Taylor,R.G.,
            Tivey,A., Walsh,S., Warren,T., Whitehead,S., Woodward,J.,
            Volckaert,G., Aert,R., Robben,J., Grymonprez,B., Weltjens,I.,
            Vanstreels,E., Rieger,M., Schafer,M., Muller-Auer,S., Gabel,C.,
            Fuchs,M., Dusterhoft,A., Fritzc,C., Holzer,E., Moestl,D.,
            Hilbert,H., Borzym,K., Langer,I., Beck,A., Lehrach,H.,
            Reinhardt,R., Pohl,T.M., Eger,P., Zimmermann,W., Wedler,H.,
            Wambutt,R., Purnelle,B., Goffeau,A., Cadieu,E., Dreano,S.,
            Gloux,S., Lelaure,V., Mottier,S., Galibert,F., Aves,S.J., Xiang,Z.,
            Hunt,C., Moore,K., Hurst,S.M., Lucas,M., Rochet,M., Gaillardin,C.,
            Tallada,V.A., Garzon,A., Thode,G., Daga,R.R., Cruzado,L.,
            Jimenez,J., Sanchez,M., del Rey,F., Benito,J., Dominguez,A.,
            Revuelta,J.L., Moreno,S., Armstrong,J., Forsburg,S.L., Cerutti,L.,
            Lowe,T., McCombie,W.R., Paulsen,I., Potashkin,J., Shpakovski,G.V.,
            Ussery,D., Barrell,B.G. and Nurse,P.
  TITLE     The genome sequence of Schizosaccharomyces pombe
  JOURNAL   Nature 415 (6874), 871-880 (2002)
   PUBMED   11859360
  REMARK    Erratum:[Nature 2003 Jan 2;421(6918):94. Cerrutti L [corrected to
            Cerutti L]]
REFERENCE   3
  AUTHORS   Wood,V., Gwilliam,R., Rajandream,M.A., Lyne,M., Lyne,R.,
            Stewart,A., Sgouros,J., Peat,N., Hayles,J., Baker,S., Basham,D.,
            Bowman,S., Brooks,K., Brown,D., Brown,S., Chillingworth,T.,
            Churcher,C., Collins,M., Connor,R., Cronin,A., Davis,P.,
            Feltwell,T., Fraser,A., Gentles,S., Goble,A., Hamlin,N., Harris,D.,
            Hidalgo,J., Hodgson,G., Holroyd,S., Hornsby,T., Howarth,S.,
            Huckle,E.J., Hunt,S., Jagels,K., James,K., Jones,L., Jones,M.,
            Leather,S., McDonald,S., McLean,J., Mooney,P., Moule,S.,
            Mungall,K., Murphy,L., Niblett,D., Odell,C., Oliver,K., O'Neil,S.,
            Pearson,D., Quail,M.A., Rabbinowitsch,E., Rutherford,K., Rutter,S.,
            Saunders,D., Seeger,K., Sharp,S., Skelton,J., Simmonds,M.,
            Squares,R., Squares,S., Stevens,K., Taylor,K., Taylor,R.G.,
            Tivey,A., Walsh,S., Warren,T., Whitehead,S., Woodward,J.,
            Volckaert,G., Aert,R., Robben,J., Grymonprez,B., Weltjens,I.,
            Vanstreels,E., Rieger,M., Schafer,M., Muller-Auer,S., Gabel,C.,
            Fuchs,M., Dusterhoft,A., Fritzc,C., Holzer,E., Moestl,D.,
            Hilbert,H., Borzym,K., Langer,I., Beck,A., Lehrach,H.,
            Reinhardt,R., Pohl,T.M., Eger,P., Zimmermann,W., Wedler,H.,
            Wambutt,R., Purnelle,B., Goffeau,A., Cadieu,E., Dreano,S.,
            Gloux,S., Lelaure,V., Mottier,S., Galibert,F., Aves,S.J., Xiang,Z.,
            Hunt,C., Moore,K., Hurst,S.M., Lucas,M., Rochet,M., Gaillardin,C.,
            Tallada,V.A., Garzon,A., Thode,G., Daga,R.R., Cruzado,L.,
            Jimenez,J., Sanchez,M., del Rey,F., Benito,J., Dominguez,A.,
            Revuelta,J.L., Moreno,S., Armstrong,J., Forsburg,S.L., Cerutti,L.,
            Lowe,T., McCombie,W.R., Paulsen,I., Potashkin,J., Shpakovski,G.V.,
            Ussery,D., Barrell,B.G. and Nurse,P.
  TITLE     The genome sequence of Schizosaccharomyces pombe
  JOURNAL   Nature 415 (6874), 871-880 (2002)
   PUBMED   11859360
  REMARK    Erratum:[Nature 2003 Jan 2;421(6918):94. Cerrutti L [corrected to
            Cerutti L]]
REFERENCE   4  (bases 1 to 1851)
  AUTHORS   Trinkl,H., Lang,B.F. and Wolf,K.
  TITLE     Nucleotide sequence of the gene encoding the small ribosomal RNA in
            the mitochondrial genome of the fission yeast Schizosaccharomyces
            pombe
  JOURNAL   Nucleic Acids Res 17 (16), 6730 (1989)
   PUBMED   2780299
REFERENCE   5  (bases 1 to 1851)
  AUTHORS   Lang,B.F., Cedergren,R. and Gray,M.W.
  TITLE     The mitochondrial genome of the fission yeast, Schizosaccharomyces
            pombe. Sequence of the large-subunit ribosomal RNA gene, comparison
            of potential secondary structure in fungal mitochondrial
            large-subunit rRNAs and evolutionary considerations
  JOURNAL   Eur J Biochem 169 (3), 527-537 (1987)
   PUBMED   2446871
REFERENCE   6  (bases 1 to 1851)
  AUTHORS   Lang,B.F., Ahne,F. and Bonen,L.
  TITLE     The mitochondrial genome of the fission yeast Schizosaccharomyces
            pombe. The cytochrome b gene has an intron closely related to the
            first two introns in the Saccharomyces cerevisiae cox1 gene
  JOURNAL   J Mol Biol 184 (3), 353-366 (1985)
   PUBMED   4046021
REFERENCE   7  (bases 1 to 1851)
  AUTHORS   Lang,B.F.
  TITLE     The mitochondrial genome of the fission yeast Schizosaccharomyces
            pombe: highly homologous introns are inserted at the same position
            of the otherwise less conserved cox1 genes in Schizosaccharomyces
            pombe and Aspergillus nidulans
  JOURNAL   EMBO J 3 (9), 2129-2136 (1984)
   PUBMED   6092057
REFERENCE   8  (bases 1 to 1851)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (16-AUG-2024) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   9
  AUTHORS   Wood,V. and Rutherford,K.
  CONSRTM   PomBase
  TITLE     Direct Submission
  JOURNAL   Submitted (13-MAR-2024) University of Cambridge, PomBase, Hopkins
            building, Tennis Court Rd, Cambridge, United Kingdom
REFERENCE   10
  AUTHORS   Wood,V.
  CONSRTM   The Schizosaccharomyces pombe Genome Sequencing Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (29-JUN-2007) European Schizosaccharomyces genome
            sequencing project, Sanger Institute, The Wellcome Trust Genome
            Campus, Hinxton, Cambridge CB10 1SA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_003424).
            
            On Jun 21, 2024 this sequence version replaced NM_001018203.2.
FEATURES             Location/Qualifiers
     source          1..1851
                     /organism="Schizosaccharomyces pombe"
                     /mol_type="mRNA"
                     /strain="972h-"
                     /db_xref="taxon:4896"
                     /chromosome="I"
     gene            1..1851
                     /locus_tag="SPOM_SPAC11D3.06"
                     /db_xref="GeneID:2542994"
                     /db_xref="PomBase:SPAC11D3.06"
     CDS             355..1722
                     /locus_tag="SPOM_SPAC11D3.06"
                     /codon_start=1
                     /product="MatE family transporter"
                     /protein_id="NP_592803.1"
                     /db_xref="GeneID:2542994"
                     /db_xref="PomBase:SPAC11D3.06"
                     /translation="MGRPLTEVKYLLINSAPVILGYALQNSLQTSSVIVTGRLGPSEL
                     SVAAFAYMFAMSTGWLIALGGTTAFDTLGSNLWGAGKKQELGILLQTGFIVLSILYLP
                     ICLVWWYSKPILIFLHQTPELAEASQKFLRYLIPGGLGYVCFELLKKFLQTQEITRAG
                     SYILLVTSPLNVALNFLLVHYYGLGLKGAPLATGLSYWLSFILLTQYAKYVKGAEAWN
                     GWNKRCLENFGPFVKLSLLGIVMVGTEWWAFEIVALVAGKLGAVPLAAQSVIMTTDQL
                     LNTIPFGLGIITSNRVAYYLGAGLPDNASLTAKVAAIVGVAVGSVIMITMIAVRNIYG
                     RIFTNDPDVIQLVALVMPLVAAFQISDSLNGTMGGALRGTGRQKVGAIVNITAYYLFA
                     LPLGIYLAFHGKGLVGLWIGQVIALSIVGILELKIVMATDWISQSRKAISRFGDSSEL
                     TALLN"
ORIGIN      
        1 accggcaaaa tatgctaact gctatcattt aagttagcaa aaactcggcg agaattccca
       61 atgtctgttg gctaagcgaa aaatattttg cgtgggtatt tctaaatttc cgtatctcca
      121 cggatatact aatgtttagc catgacatct gaagttttat gccctaaatg tgcggcttct
      181 aagcgttctc tgatataaat ttatggttcc atccgttcaa tcaatatgat aaaagcttag
      241 taaactttta ttaaaggaaa atttgaacct tcggtgaaca gacattaaga agtactcttt
      301 atttatatta aaaaatacac cgtatatcca aattttctct gagaaagcac tattatgggt
      361 agaccactta cagaggtgaa ataccttttg ataaattcag ctccggtaat ccttggatat
      421 gccttgcaaa actctttgca aactagttca gttattgtaa ccgggcgcct tggaccaagc
      481 gagctttccg tagctgcttt tgcgtacatg tttgcgatga gcacaggctg gctgattgct
      541 ctaggtggaa ctactgcttt tgacacactt ggctccaacc tttggggagc cggaaaaaaa
      601 caagaattgg gaattctatt gcaaacgggt ttcatcgtgc tcagtattct atatctgcca
      661 atatgtttag tttggtggta ttctaaaccc atcctaattt tcttgcatca aacacctgaa
      721 ttagctgaag cttcacaaaa gtttttacga taccttatcc caggcggact aggttatgta
      781 tgttttgaat tgctaaaaaa gtttttgcaa acacaagaaa tcactagggc tggttcttat
      841 attcttctag ttacctctcc tcttaatgtc gccttaaatt ttctacttgt ccattattat
      901 ggattaggtt taaaaggcgc tccattggca actggattat cgtactggct ttcattcatt
      961 ttattaactc aatatgcgaa atacgtaaaa ggggcagagg cgtggaatgg ttggaataaa
     1021 cgatgcttag agaactttgg accttttgta aagttatcac tattgggtat cgttatggtg
     1081 ggaacagaat ggtgggcttt tgaaatagta gcactagttg ctggtaaact tggtgctgta
     1141 ccacttgccg ctcaatcagt aattatgacc acagatcaat tacttaacac aattcctttc
     1201 ggtctcggaa taattacttc taatcgagtt gcctactatc tcggagctgg gttacctgac
     1261 aatgcttctc taactgctaa ggtcgcagca attgtaggtg ttgcagtagg aagcgttatc
     1321 atgattacca tgattgccgt acgcaatatc tatggacgga ttttcacaaa tgatccagat
     1381 gtcattcagc tggttgctct tgtaatgccc ttagtagctg ctttccaaat atcagattcc
     1441 ttgaatggta caatgggagg agctttaaga ggcacgggaa gacagaaggt tggcgctata
     1501 gttaacatta ctgcctacta tttgtttgct ctgcctctag gaatttattt agccttccat
     1561 ggcaaaggtc ttgtcggtct ttggattgga caggtaatag cgttatccat agtcggaatt
     1621 ttagaactga aaattgtaat ggcaactgac tggatttccc aatcaagaaa ggcaatctca
     1681 agatttggtg actcctctga attgactgca ctactcaatt agacatttgg gtcgatgcat
     1741 gtagttgatc aagcaaaata gtttgataat agcttcattg ttaaccggta atgatgttca
     1801 ccatgtacat taaagcaaat aaattattaa taaaacaacg ttactttcat a
//