Dbfetch
ID AY086511; SV 1; linear; mRNA; STD; PLN; 1043 BP. XX AC AY086511; XX DT 14-JUN-2002 (Rel. 72, Created) DT 24-FEB-2006 (Rel. 86, Last updated, Version 4) XX DE Arabidopsis thaliana clone 25530 mRNA, complete sequence. XX KW FLI_CDNA. XX OS Arabidopsis thaliana (thale cress) OC Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; OC Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; OC rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis. XX RN [1] RP 1-1043 RX PUBMED; 12093376. RA Haas B.J., Volfovsky N., Town C.D., Troukhan M., Alexandrov N., RA Feldmann K.A., Flavell R.B., White O., Salzberg S.L.; RT "Full-length messenger RNA sequences greatly improve genome annotation"; RL Genome Biol. 3(6):RESEARCH0029-RESEARCH0029(2002). XX RN [2] RP 1-1043 RA Alexandrov N.A., Troukhan M.E., Brover V.V., Flavell R.B., Feldmann K.A.; RT "Features of Arabidopsis genes and genome discovered using full-length RT cDNAs"; RL Plant Mol. Biol. 60(1):71-87(2006). XX RN [3] RP 1-1043 RA Brover V., Troukhan M., Alexandrov N., Lu Y.-P., Flavell R., Feldmann K.; RT ; RL Submitted (11-MAR-2002) to the INSDC. RL Ceres, Inc, 3007 Malibu Canyon Road, Malibu, CA 90265, USA XX DR MD5; 44aaaab30ff82aab32bbca7023fceb7f. XX CC This clone sequence is one of 5,000 Ceres full-length cDNAs made CC available to TIGR and Genbank. The following quality assessment of CC this set was done by comparison with known proteins: two percent of CC the clones are estimated to be 5'-truncated; less than one percent CC are 3'-truncated; approximately two percent represent alternative CC splice variants, including unspliced introns and spliced exons; one CC percent may contain premature stop codons; five percent may have CC frame shifts in a coding region. A sequence is considered to be CC 5'-truncated if it lacks the translation initiation start (ATG). A CC sequence is considered to be 3'-truncated if it lacks the CC C-terminal end of the encoded protein. Please note that these cDNA CC sequences are derived from the Ws or LAer ecotypes and therefore CC may contain polymorphisms when compared to sequences from Col-0. CC Genset carried out the library production and sequencing of the CC full-length clones. Ceres, Inc. carried out the clustering of the CC 5' sequences, selection of clones, and sequence assembly. XX FH Key Location/Qualifiers FH FT source 1..1043 FT /organism="Arabidopsis thaliana" FT /mol_type="mRNA" FT /clone="25530" FT /db_xref="taxon:3702" FT CDS 136..927 FT /codon_start=1 FT /product="putative ABC transporter" FT /db_xref="GOA:Q9C9W0" FT /db_xref="InterPro:IPR003439" FT /db_xref="InterPro:IPR003593" FT /db_xref="InterPro:IPR005670" FT /db_xref="InterPro:IPR017871" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/Swiss-Prot:Q9C9W0" FT /protein_id="AAM63511.1" FT /translation="MPSLWSNESDGSLREHLVDVVVSGSEPKIRVHDLTRVADDGSRIL FT KGVTIDIPKGMIVGVIGPSGSGKSTFLRSLNRLWEPPESTVFLDGEDITNVDVIALRRR FT VGMLFQLPVLFQGTVADNVRYGPNLRGEKLSDEEVYKLLSLADLDASFAKKTGAELSVG FT QAQRVALARTLANEPEVLLLDEPTSALDPISTENIEDVIVKLKKQRGITTVIVSHSIKQ FT IQKVADIVCLVVDGEIVEVLKPSELSHATHPMAQRFLQLSS" XX SQ Sequence 1043 BP; 288 A; 180 C; 252 G; 322 T; 1 other; aaaagttggc cactaagtgg tgtaagaata ataaattgtc aatatcaatt gactgattct 60 tattgttcat atacggacac aaatcttttc gttaagtgag tgttttgatc aaaaaaagtt 120 gaaaacttta aagccatgcc atcactttgg tctaacgaat ccgatggatc attacgagag 180 catcttgtgg atgttgttgt gtctggttca gaaccaaaga ttcgggtaca tgatctgacc 240 cgagtcgccg atgatggatc tcggatcttg aaaggagtta cgatagatat accaaaaggt 300 atgatcgttg gtgtgattgg acctagtgga agtggaaagt caacgttttt gagatctctg 360 aatcgtcttt gggaaccacc ggagtcaact gtgttcttgg acggtgaaga tataaccaac 420 gttgatgtta ttgctcttcg tcgtagagtt ggaatgcttt ttcagcttcc tgttcttttt 480 caagggactg ttgcggataa tgtgagatat ggtccgaatt tgagagggga gaaactaagt 540 gacgaagagg tttataagct gctaagtctt gcagaccttg atgcttcctt tgctaagaag 600 actggtgcag agttatctgt gggtcaagct caacgagtag cacttgcaag gactctagcc 660 aacgagcctg aggtgttgct gctcgatgaa ccaacaagtg ctcttgatcc gatatcgaca 720 gagaacattg aggatgttat agtgaaactg aagaagcaga gagggattac tactgtgatt 780 gtttctcaca gtatcaagca gattcagaaa gttgctgata tcgtttgcct tgttgtcgac 840 ggagagattg ttgaagttct taaaccaagt gagctttcgc acgctacgca tccaatggca 900 cagaggtttc ttcaactcag ttcttgagac cattttctca ttgatggttc ctgcaagtta 960 tttgctattt tgcttgaatc ttaataatct ctttcaagag aggaacaaat gctggttgaa 1020 tgtaacaacm cctttcatgg ttt 1043 //