M16287 Human fos proto-oncogene (c-fos), complete cds. c-myc proto-oncogene fos oncogene proto-oncogene Complete nucleotide sequence of a human c-onc gene: deduced amino acid sequence of the human c-fos protein van Straaten F. Muller R. Curran T. Van Beveren C. Verma I.M. Transient accumulation of c-fos RNA following serum stimulation requires a conserved 5' element and c-fos 3' sequences Treisman R. /tmp/dbfetch_cmd_7247667015278316485.tmp(39): warning W00017: missing last page, assuming last page = first page: Cold Spring Harb. Symp. Quant. Biol. 51:0. Human fos gene Verma I.M. Deschamps J. Van Beveren C. Sassone-Corsi P. [2] sites; promoter region. C-fos is the human cellular homolog of the v-fos oncogene of Finkel-Biskis-Jinkins murine osteosarcoma virus (FBJ-MuSV). [2] It was found that both human and murine c-fos genes contained an enhancer-like element in their 5' noncoding regions that was necessary for increased transcription following serum activation. The FBJ-MuSV v-fos oncogene contains a deletion relative to murine and human c-fos proto-oncogenes that causes complete divergence of the COOH terminal protein sequences encoded. That deletion corresponds to positions 3182-3285 inclusive of this sequence. The FBJ-MuSV v-fos sequence is more closely related to murine than human c-fos sequences. The FBJ-MuSV v-fos coding sequence ends at a 'tag' stop codon coresponding to positions 3434-2436 of this sequence [1]. [1] notes two alu repeats beginning aproximately 500 and 1700 nucleotides downstream of the last base in this sequence. A TATA box is located at positions 701-707. Two potential polyadenylation signals are present in the 3' untranslated region. Homo sapiens human 9606 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo 14q24.3 genomic DNA 1 6210 transcriptional activator region [2] 402 453 c-fos mRNA [1] 734 3329 FOS 889 1029 1 c-fos protein AAA52471.1 MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL 889 1029 1783 2034 2466 2573 2688 3329 FOS 1 c-fos protein; G00-119-917 889 1029 c-fos intron A 1030 1782 2 1783 2034 c-fos intron B 2035 2465 3 2466 2573 c-fos intron C 2574 2687 4 c-fos protein 2688 3329