ID M10051; SV 1; linear; mRNA; STD; HUM; 4723 BP. XX AC M10051; XX DT 02-JUL-1986 (Rel. 09, Created) DT 14-NOV-2006 (Rel. 89, Last updated, Version 7) XX DE Human insulin receptor mRNA, complete cds. XX KW insulin receptor; tyrosine kinase. XX OS Homo sapiens (human) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; OC Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; OC Homo. XX RN [1] RP 1-4723 RX DOI; 10.1016/0092-8674(85)90334-4. RX PUBMED; 2859121. RA Ebina Y., Ellis L., Jarnagin K., Edery M., Graf L., Clauser E., Ou J.-H., RA Masiarz F., Kan Y.W., Goldfine I.D., Roth R.A., Rutter W.J.; RT "The human insulin receptor cDNA: the structural basis for RT hormone-activated transmembrane signalling"; RL Cell 40(4):747-758(1985). XX DR MD5; e4e6ebf2e723a500c1dd62385c279351. DR Ensembl-Gn; ENSG00000171105; homo_sapiens. DR Ensembl-Tr; ENST00000302850; homo_sapiens. DR Ensembl-Tr; ENST00000341500; homo_sapiens. DR EuropePMC; PMC2739203; 19682364. DR EuropePMC; PMC3164640; 21909271. DR EuropePMC; PMC452597; 15146055. XX CC [1] suggests that the insulin receptor may be the cellular homolog CC of the v-ros transforming (oncogene) protein. [1] notes CC similarities between the insulin receptor and several growth factor CC receptors and oncogenes. Insulin receptor is a heterodimer CC consisting of 2 alpha and 2 beta subunits. Beta-prime may be a CC cleavage product produced upon binding of insulin. [1] suggests CC that translation may begin at the 'atg' start codon at positions CC 79-81 with protein cleavage occurring after position 120 to yield CC the signal peptide. [1] gives illustrations of the various domains CC present in the protein. A draft entry and sequence for [1] in CC computer-readable form were kindly provided by K. Jarnagin CC (30-JUL-1985). XX FH Key Location/Qualifiers FH FT source 1..4723 FT /organism="Homo sapiens" FT /map="19p13.3-p13.2" FT /mol_type="mRNA" FT /db_xref="taxon:9606" FT sig_peptide 137..219 FT /note="insulin receptor signal peptide" FT CDS 139..4287 FT /codon_start=1 FT /gene="INSR" FT /note="insulin receptor precursor" FT /db_xref="GOA:P06213" FT /db_xref="H-InvDB:HIT000194074.15" FT /db_xref="HGNC:HGNC:6091" FT /db_xref="InterPro:IPR000494" FT /db_xref="InterPro:IPR000719" FT /db_xref="InterPro:IPR001245" FT /db_xref="InterPro:IPR002011" FT /db_xref="InterPro:IPR003961" FT /db_xref="InterPro:IPR006211" FT /db_xref="InterPro:IPR006212" FT /db_xref="InterPro:IPR008266" FT /db_xref="InterPro:IPR009030" FT /db_xref="InterPro:IPR011009" FT /db_xref="InterPro:IPR013783" FT /db_xref="InterPro:IPR016246" FT /db_xref="InterPro:IPR017441" FT /db_xref="InterPro:IPR020635" FT /db_xref="InterPro:IPR036116" FT /db_xref="InterPro:IPR036941" FT /db_xref="InterPro:IPR040969" FT /db_xref="PDB:1GAG" FT /db_xref="PDB:1I44" FT /db_xref="PDB:1IR3" FT /db_xref="PDB:1IRK" FT /db_xref="PDB:1P14" FT /db_xref="PDB:1RQQ" FT /db_xref="PDB:2AUH" FT /db_xref="PDB:2B4S" FT /db_xref="PDB:2HR7" FT /db_xref="PDB:2MFR" FT /db_xref="PDB:2Z8C" FT /db_xref="PDB:3BU3" FT /db_xref="PDB:3BU5" FT /db_xref="PDB:3BU6" FT /db_xref="PDB:3EKK" FT /db_xref="PDB:3EKN" FT /db_xref="PDB:3ETA" FT /db_xref="PDB:3W11" FT /db_xref="PDB:3W12" FT /db_xref="PDB:3W13" FT /db_xref="PDB:4IBM" FT /db_xref="PDB:4OGA" FT /db_xref="PDB:4XLV" FT /db_xref="PDB:4XSS" FT /db_xref="PDB:4XST" FT /db_xref="PDB:4ZXB" FT /db_xref="PDB:5E1S" FT /db_xref="PDB:5HHW" FT /db_xref="PDB:5J3H" FT /db_xref="PDB:5KQV" FT /db_xref="PDB:5U1M" FT /db_xref="PDB:6HN4" FT /db_xref="PDB:6HN5" FT /db_xref="UniProtKB/Swiss-Prot:P06213" FT /protein_id="AAA59174.1" FT /translation="MGTGGRRGAAAAPLLVAVAALLLGAAGHLYPGEVCPGMDIRNNLT FT RLHELENCSVIEGHLQILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFP FT NLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRI FT LDSVEDNHIVLNKDDNEECGDICPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTI FT CKSHGCTAEGLCCHSECLGNCSQPDDPTKCVACRNFYLDGRCVETCPPPYYHFQDWRCV FT NFSFCQDLHHKCKNSRRQGCHQYVIHNNKCIPECPSGYTMNSSNLLCTPCLGPCPKVCH FT LLEGEKTIDSVTSAQELRGCTVINGSLIINIRGGNNLAAELEANLGLIEEISGYLKIRR FT SYALVSLSFFRKLRLIRGETLEIGNYSFYALDNQNLRQLWDWSKHNLTTTQGKLFFHYN FT PKLCLSEIHKMEEVSGTKGRQERNDIALKTNGDKASCENELLKFSYIRTSFDKILLRWE FT PYWPPDFRDLLGFMLFYKEAPYQNVTEFDGQDACGSNSWTVVDIDPPLRSNDPKSQNHP FT GWLMRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSS FT SQIILKWKPPSDPNGNITHYLVFWERQAEDSELFELDYCLKGLKLPSRTWSPPFESEDS FT QKHNQSEYEDSAGECCSCPKTDSQILKELEESSFRKTFEDYLHNVVFVPRKTSSGTGAE FT DPRPSRKRRSLGDVGNVTVAVPTVAAFPNTSSTSVPTSPEEHRPFEKVVNKESLVISGL FT RHFTGYRIELQACNQDTPEERCSVAAYVSARTMPEAKADDIVGPVTHEIFENNVVHLMW FT QEPKEPNGLIVLYEVSYRRYGDEELHLCVSRKHFALERGCRLRGLSPGNYSVRIRATSL FT AGNGSWTEPTYFYVTDYLDVPSNIAKIIIGPLIFVFLFSVVIGSIYLFLRKRQPDGPLG FT PLYASSNPEYLSASDVFPCSVYVPDEWEVSREKITLLRELGQGSFGMVYEGNARDIIKG FT EAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMA FT HGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCM FT VAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVV FT LWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFL FT EIVNLLKDDLHPSFPEVSFFHSEENKAPESEELEMEFEDMENVPLDRSSHCQREEAGGR FT DGGSSLGFKRSYEEHIPYTHMNGGKKNGRILTLPRSNPS" FT mat_peptide 220..2424 FT /gene="INSR" FT /note="insulin receptor alpha subunit" FT mat_peptide 2425..4284 FT /gene="INSR" FT /note="insulin receptor beta subunit" FT mat_peptide 2425..2469 FT /partial FT /gene="INSR" FT /note="insulin receptor beta-prime subunit" XX SQ Sequence 4723 BP; 1068 A; 1298 C; 1311 G; 1046 T; 0 other;