ID Z14123; SV 1; linear; genomic RNA; STD; VRL; 647 BP. XX AC Z14123; XX DT 29-JUL-1992 (Rel. 32, Created) DT 24-NOV-1994 (Rel. 41, Last updated, Version 5) XX DE Barley yellow dwarf virus gene for capsid protein XX KW capsid protein. XX OS Barley yellow dwarf virus OC Viruses; Riboviria; Luteoviridae; Luteovirus; unclassified Luteovirus. XX RN [1] RC (sites) RX PUBMED; 7928284. RA Domier L.L., Lukasheva L.I., D'Arcy C.J.; RT "Coat protein sequences of RMV-like strains of barley yellow dwarf virus RT separate them from other luteoviruses"; RL Intervirology 37(1):2-5(1994). XX RN [2] RP 1-647 RA Domier L.L.; RT ; RL Submitted (28-JUL-1992) to the INSDC. RL Domier L. L., USDA, ARS, MWA - University of Illinois, Plant Pathology, RL 1102 South Goodwin Ave., Urbana, Illinois, 61801 XX DR MD5; 5714470422f97e0c7cc8eb07cea1a235. DR EuropePMC; PMC4885075; 27136578. XX FH Key Location/Qualifiers FH FT source 1..647 FT /organism="Barley yellow dwarf virus" FT /strain="RMV" FT /isolate="Illinois" FT /mol_type="genomic RNA" FT /clone="RMVILCP" FT /db_xref="taxon:12037" FT CDS 48..641 FT /product="capsid protein" FT /function="capsid protein" FT /db_xref="GOA:Q65880" FT /db_xref="InterPro:IPR001517" FT /db_xref="InterPro:IPR029053" FT /db_xref="UniProtKB/TrEMBL:Q65880" FT /citation=[1] FT /protein_id="CAA78496.1" FT /translation="MNTGGRNGRRARNRRRVRNNNRAQPVVVVAANPRRGRSRRRRRSS FT GNITGRPGVRRGSRETFVFSKDSIAGNASGKITFGPSLSECAAFSGGILKAYHEYKISK FT IILEFISEAASTAEGSIAYELDSHNKLSTLGSTINKFSIVKGGRKAFTSNQIGGGVWRD FT STEDQCAILYKGNGKSSVAGSFRITIEVIVQNPK" XX SQ Sequence 647 BP; 182 A; 164 C; 162 G; 139 T; 0 other; gtacaagatc tacctatcta tctcctcgaa cgtgcgttca atcgtgaatg aatacgggag 60 gtagaaatgg acgtagagca aggaaccgcc gacgcgttcg caataataac cgggcccagc 120 cagtggttgt ggtcgcggca aatccgcgtc gaggacgctc tcgaagacga agacgatcaa 180 gtggaaacat tacaggaaga cctggagtca gacgaggctc gcgggagact tttgtatttt 240 caaaggactc tatcgcgggc aacgcctccg ggaaaatcac cttcggaccg tctttatcag 300 agtgtgcagc attcagtggc ggaattctca aggcctacca tgagtataag atctcaaaga 360 tcatactgga gttcatctcc gaggccgctt ccaccgccga aggttccatc gcttatgaac 420 ttgattcaca caacaagctc tcaacccttg gctccaccat caacaaattc tcaatcgtca 480 aaggtggcag aaaggcattt acgtccaatc aaatcggagg tggagtttgg cgcgactcaa 540 cagaagacca gtgcgccatt ctctacaaag gtaacggaaa gtcctcggtc gcgggttcgt 600 tcagaatcac gattgaggtc attgttcaaa accccaaata ggtagac 647 //