ID S78319; SV 1; linear; genomic RNA; STD; VRL; 657 BP. XX AC S78319; XX DT 31-OCT-1995 (Rel. 45, Created) DT 01-SEP-2004 (Rel. 81, Last updated, Version 3) XX DE CP=coat protein {RNA3} [apple mosaic virus ApMV, Genomic RNA, 657 nt]. XX KW . XX OS Apple mosaic virus OC Viruses; Riboviria; Bromoviridae; Ilarvirus. XX RN [1] RC GenBank staff at the National Library of Medicine created this entry [NCBI RC gibbsq 167598] from the original journal article. RP 1-657 RX PUBMED; 7730792. RA Guo D., Maiss E., Adam G., Casper R.; RT "Prunus necrotic ringspot ilarvirus: nucleotide sequence of RNA3 and the RT relationship to other ilarviruses based on coat protein comparison"; RL J. Gen. Virol. 76(Pt 5):1073-1079(1995). XX DR MD5; 0d43d0f3221b7a8b26d32ce99e89ace5. DR EuropePMC; PMC3550718; 23637501. XX FH Key Location/Qualifiers FH FT source 1..657 FT /organism="Apple mosaic virus" FT /mol_type="genomic RNA" FT /db_xref="taxon:12319" FT gene 1..657 FT /gene="CP" FT CDS 1..657 FT /codon_start=1 FT /gene="CP" FT /product="CP" FT /note="coat protein" FT /db_xref="GOA:Q86921" FT /db_xref="InterPro:IPR002681" FT /db_xref="UniProtKB/TrEMBL:Q86921" FT /protein_id="AAB34203.1" FT /translation="MVCKYCGHTHPGACVNCKWCHGTNRPAPPKRAVVRALANPNKGKT FT PVKGGPSVRRTAWEVRGPNVEPKIPKGHRALSSREVTATVEGKFVNIDFADVFRDLLEK FT DLKVHTFIIRVNSLSSNGWIGLVEDYDESNPKGPNPMDRKGFKKDQPRGWQWEAPPNTS FT FDDFVRKFRLVLEFKTNFAAGAKVFMRDLYVITSELPPVQIPMNVLLIDEDLLEL" XX SQ Sequence 657 BP; 178 A; 134 C; 187 G; 158 T; 0 other; atggtctgca agtactgtgg tcacactcac cctggagctt gcgttaattg caagtggtgt 60 cacggaacga atagacctgc tcctccgaag cgcgccgttg ttcgcgccct agcgaacccg 120 aataagggaa aaactcccgt gaagggaggt ccatccgtga ggaggacggc ttgggaggtt 180 agaggcccga atgtggaacc aaagattcca aagggtcaca gggctttgag cagtcgagaa 240 gtgactgcca cggttgaagg caagttcgtg aatatcgact ttgccgatgt cttccgcgat 300 ctgctagaga aggatttgaa ggtgcacacc ttcataatcc gagtgaacag tctatcctct 360 aatgggtgga tcggtctagt agaggattac gatgagagta atccgaaagg tccgaatccg 420 atggaccgaa aaggcttcaa aaaggaccaa ccgagaggtt ggcagtggga agcccctcca 480 aacacatctt ttgatgactt cgtgaggaag tttagattgg ttttggagtt taagacgaat 540 ttcgccgctg gtgcgaaagt ctttatgagg gatttgtacg tgataacgag tgagttacca 600 ccggtacaaa taccgatgaa tgttctactt atcgatgaag atttgttaga attatga 657 //