ID   L00162; SV 1; linear; genomic RNA; STD; VRL; 964 BP.
XX
AC   L00162; J02006;
XX
DT   03-JUL-1991 (Rel. 28, Created)
DT   31-AUG-2006 (Rel. 89, Last updated, Version 5)
XX
DE   Alfalfa mosaic virus (strain 425 Leiden) RNA 4 encoding viral coat protein.
XX
KW   coat protein; subgenome.
XX
OS   Alfalfa mosaic virus
OC   Viruses; Riboviria; Bromoviridae; Alfamovirus.
XX
RN   [1]
RP   84-157
RX   DOI; 10.1073/pnas.74.12.5504.
RX   PUBMED; 271973.
RA   Koper-Zwarthoff E.C., Lockard R.E., Alzner-DeWeerd B., RajBhandary U.L.,
RA   Bol J.F.;
RT   "Nucleotide sequence of 5' terminus of alfalfa mosaic virus RNA 4 leading
RT   into coat protein cistron";
RL   Proc. Natl. Acad. Sci. U.S.A. 74(12):5504-5508(1977).
XX
RN   [2]
RP   872-962
RX   DOI; 10.1073/pnas.76.3.1114.
RX   PUBMED; 108677.
RA   Koper-Zwarthoff E.C., Bol J.F.;
RT   "3'-Terminal nucleotide sequence of alfalfa mosaic virus RNA 4";
RL   Proc. Natl. Acad. Sci. U.S.A. 76(3):1114-1117(1979).
XX
RN   [3]
RP   84-964
RX   DOI; 10.1093/nar/8.10.2213.
RX   PUBMED; 7433090.
RA   Brederode F.T.M., Koper-Zwarthoff E.C., Bol J.F.;
RT   "Complete nucleotide sequence of alfalfa mosaic virus RNA 4";
RL   Nucleic Acids Res. 8(10):2213-2223(1980).
XX
RN   [4]
RP   1-184
RX   DOI; 10.1093/nar/8.23.5635.
RX   PUBMED; 6927843.
RA   Koper-Zwarthoff E.C., Brederode F.T., Veeneman G., van Boom J.H., Bol J.F.;
RT   "Nucleotide sequences at the 5'-termini of the alfalfa mosaic virus RNAs
RT   and the intercistronic junction in RNA 3";
RL   Nucleic Acids Res. 8(23):5635-5647(1980).
XX
RN   [5]
RP   508-557,750-964
RX   DOI; 10.1021/bi00257a025.
RX   PUBMED; 6810924.
RA   Houwing C.J., Jaspars E.M.J.;
RT   "Protein binding sites in nucleation complexes of alfalfa mosaic virus RNA
RT   4";
RL   Biochemistry 21(14):3408-3414(1982).
XX
RN   [6]
RX   PUBMED; 18639831.
RA   Joshi S., Neeleman L., Pleij C.W.A., Haenni A.-L., Chapeville F., Bosch L.,
RA   van Vloten-Doting L.;
RT   "Nonstructural alfalfa mosaic virus RNA-coded proteins present in tobacco
RT   leaf tissue";
RL   Virology 139(2):231-242(1984).
XX
DR   MD5; dfa9117c146e7e1f45ea953f660627fc.
DR   EuropePMC; PMC3807391; 23903837.
DR   RFAM; RF00252; Alfamo_CPB.
XX
CC   [6]  sites; readthrough phenomena in ALMV.
CC   RNA 4 is identical to 3' end of genomic RNA 3.  Bases 816-964 (3'
CC   terminus) are homologous in all ALMV RNA species. [5] provides coat
CC   protein attachment sites on RNA 4: the sites include those for
CC   complex I and complex III (internal site and sites 1, 2 and 3). [6]
CC   discusses the possibility that readthrough products of the 35 kd
CC   protein cistron into the coat protein could be produced by a frame
CC   shift mechanism.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..964
FT                   /organism="Alfalfa mosaic virus"
FT                   /mol_type="genomic RNA"
FT                   /db_xref="taxon:12321"
FT   mRNA            84..964
FT                   /note="coat protein mRNA"
FT   CDS             120..785
FT                   /codon_start=1
FT                   /note="coat protein"
FT                   /db_xref="GOA:P03591"
FT                   /db_xref="InterPro:IPR002681"
FT                   /db_xref="UniProtKB/Swiss-Prot:P03591"
FT                   /protein_id="AAA46297.1"
FT                   /translation="MSSSQKKAGGKAGKPTKRSQNYAALRKAQLPKPPALKVPVVKPTN
FT                   TILPQTGCVWQSLGTPLSLSSFNGLGARFLYSFLKDFVGPRILEEDLIYRMVFSITPSH
FT                   AGTFCLTDDVTTEDGRAVAHGNPMQEFPHGAFHANEKFGFELVFTAPTHAGMQNQNFKH
FT                   SYAVALCLDFDAQPEGSKNPSFRFNEVWVERKAFPRAGPLRSLITVGLFDEADDLDRH"
XX
SQ   Sequence 964 BP; 236 A; 223 C; 231 G; 270 T; 4 other;
     gggtcttgga gtcccgaaag ggtttncntn tgaaagtttt nttaaagatg aaatattacc        60
     tgatcattga tcggtaatgg gccgttttta tttttaattt tctttcaaat acttccatca       120
     tgagttcttc acaaaagaaa gctggtggga aagctggtaa acctactaaa cgttctcaga       180
     actatgctgc tttacgcaaa gctcaactgc cgaagcctcc ggcgttgaaa gtcccggttg       240
     taaaaccgac gaatactata ctgccacaga cgggctgcgt gtggcaaagc ctcgggaccc       300
     ctctgagtct gagctctttt aatgggctcg gcgcgagatt cctctacagt tttctgaagg       360
     atttcgtggg acctcggatc ctcgaagagg atctgattta caggatggtg ttttccataa       420
     caccgtccca tgccggcacc ttttgtctca ctgatgacgt gacgactgag gatggtaggg       480
     ccgtcgcgca tggtaatccc atgcaagaat ttcctcatgg cgcgtttcac gccaatgaga       540
     agttcgggtt tgagttggtc ttcacagctc ctacccatgc gggaatgcaa aatcaaaatt       600
     tcaagcattc ctatgccgta gccctctgtc tggacttcga tgcgcagcct gagggatcta       660
     aaaatccctc attccgattc aacgaagttt gggtcgagag aaaggcgttc ccgcgagcag       720
     ggcccctccg cagtttgatt actgtggggc tgttcgacga agctgacgat cttgatcgtc       780
     attgatttac cccattaatt tgggatgcta aagtcattta atgctgacct ccactgggtg       840
     gattaaggtc aaggtatgaa gtcctattcg ctcctgatag gatcgacttc atattgctta       900
     tatatgtgct aacgcacata tataaatgct catgcaaaac tgcatgaatg cccctaaggg       960
     atgc                                                                    964
//