ID JX982324; SV 1; linear; genomic RNA; STD; VRL; 567 BP. XX AC JX982324; XX DT 12-MAY-2013 (Rel. 116, Created) DT 12-MAY-2013 (Rel. 116, Last updated, Version 1) XX DE Andean potato latent virus isolate Bo-15 coat protein gene, complete cds. XX KW . XX OS Andean potato latent virus OC Viruses; Riboviria; Tymovirales; Tymoviridae; Tymovirus. XX RN [1] RP 1-567 RX DOI; 10.1016/j.virusres.2013.01.014. RX PUBMED; 23357297. RA Kreuze J., Koenig R., De Souza J., Vetten H.J., Muller G., Flores B., RA Ziebell H., Cuellar W.; RT "The complete genome sequences of a Peruvian and a Colombian isolate of RT Andean potato latent virus and partial sequences of further isolates RT suggest the existence of two distinct potato-infecting tymovirus species"; RL Virus Res. 173(2):431-435(2013). XX RN [2] RP 1-567 RA Koenig R.; RT ; RL Submitted (17-OCT-2012) to the INSDC. RL Institute for Epidemiology and Pathogen Diagnostics, Julius Kuhn Institute, RL Messeweg 11, Braunschweig D38104, Germany XX DR MD5; 5dfa3650e7513444422c02a83e2650cb. XX FH Key Location/Qualifiers FH FT source 1..567 FT /organism="Andean potato latent virus" FT /isolate="Bo-15" FT /mol_type="genomic RNA" FT /db_xref="taxon:73819" FT CDS 1..567 FT /codon_start=1 FT /product="coat protein" FT /db_xref="GOA:R4L321" FT /db_xref="InterPro:IPR000574" FT /db_xref="InterPro:IPR029053" FT /db_xref="UniProtKB/TrEMBL:R4L321" FT /protein_id="AGL11963.1" FT /translation="MSTSITTVSKQPSINAPGHTLPTPSSELSPAMVLPFQFTATTLGM FT AETASQITLVSSSAINKLMLSYRHCQLIECSAELTPFAGAISNPLSVNLVWVSANSTGT FT PMDILNIYGGSSFVLGGPITAPTPISIPLPFNSVNVVLKDSTIYTDTPKLLAYSPLPAS FT PSKTPTASIQIRGKLRLSSPLLQPN" XX SQ Sequence 567 BP; 131 A; 209 C; 71 G; 156 T; 0 other; atgtctacat ccatcaccac tgtttccaaa caaccatcca tcaatgctcc tggacatacc 60 ctacccactc cttcctcaga actttcacca gcaatggttc tcccttttca gttcaccgcc 120 accactcttg gaatggctga aacagcttct caaatcaccc tcgtttcttc atccgccatc 180 aacaaactca tgctctccta tcgtcattgc caactgatcg aatgttcagc agaactcact 240 ccttttgctg gcgccatatc caacccactc tctgttaacc ttgtttgggt ttccgccaat 300 tccactggaa ctcccatgga cattctcaac atttacggtg gttcctcctt cgtcctcgga 360 ggaccaatca ccgcacccac accaatttct atcccacttc cttttaactc tgtgaatgtt 420 gtcttgaaag acagcaccat ttacacagac accccgaaac tcctggccta ctctcctctt 480 ccggcctctc cttccaaaac ccctaccgcg tccatccaaa tccgcggaaa actccgtctt 540 tcctcacctc tcctccaacc caattag 567 //