ID JX468871; SV 1; linear; genomic RNA; STD; VRL; 807 BP. XX AC JX468871; XX DT 15-OCT-2012 (Rel. 114, Created) DT 13-JUN-2014 (Rel. 121, Last updated, Version 2) XX DE Cherry green ring mottle virus isolate IV-20 coat protein gene, complete DE cds. XX KW . XX OS Cherry green ring mottle virus OC Viruses; Riboviria; Tymovirales; Betaflexiviridae; Quinvirinae; OC Robigovirus. XX RN [1] RP 1-807 RX DOI; 10.1016/j.mcp.2014.03.002. RX PUBMED; 24675146. RA Komorowska B., Fiore N., Zamorano A., Li R.; RT "Simultaneous detection of Cherry necrotic rusty mottle virus and Cherry RT green ring mottle virus using real-time PCR and high resolution melting RT analysis"; RL Mol. Cell. Probes 28(4):186-191(2014). XX RN [2] RP 1-807 RA Komorowska B.; RT ; RL Submitted (08-AUG-2012) to the INSDC. RL Plant Protection, Research Institute of Horticulture, Konstytucji 3 Maja RL 1/3, Skierniewice, Lodzkie 96-100, Poland XX DR MD5; 25fd0261055d7e47898085a4b29e7bb2. XX FH Key Location/Qualifiers FH FT source 1..807 FT /organism="Cherry green ring mottle virus" FT /host="sweet cherry" FT /isolate="IV-20" FT /mol_type="genomic RNA" FT /country="Poland" FT /collection_date="20-May-2010" FT /db_xref="taxon:65467" FT CDS 1..807 FT /codon_start=1 FT /product="coat protein" FT /db_xref="GOA:K4J3K5" FT /db_xref="InterPro:IPR000052" FT /db_xref="UniProtKB/TrEMBL:K4J3K5" FT /protein_id="AFU72307.1" FT /translation="MADEEFEKNSDGTFKLDAQGKRIPKKPQAQTDPKSSNPQDPNSKK FT SDVDILRARRKRVTFNPSDPTSSPSRSFINSIQETNPVTLNIASDDTVKAITSDWVEFL FT KIKQEEVFDCIFDVVLFCYHNSSSDKTKMVGKARNGIGLEDLASTVRSYCSLRSFCSKY FT APVIWNYGISNDLPPANWQRRKVVEGAKFAAFDFFEAVTSEAALQPVEGLVRNPTDKEM FT TAGASLKEISLMRDEIRRGTSSTLMTEVTGGRTGQIQPIKKIGGDE" XX SQ Sequence 807 BP; 243 A; 183 C; 195 G; 186 T; 0 other; atggctgatg aagaatttga gaagaactct gatggaacct tcaagcttga cgcccaaggg 60 aaaaggatcc caaagaagcc acaggcgcag acggacccta agtcctccaa ccctcaggat 120 ccgaattcca agaaaagtga cgttgacata ctgcgagcca gaagaaaaag agtcactttt 180 aatccatccg atcccacctc tagccctagc agaagcttta tcaactcaat tcaggagacg 240 aatccagtta cgctcaatat cgcctctgat gacaccgtca aggcaatcac atccgactgg 300 gttgaatttc tcaaaattaa gcaggaagag gtctttgact gcatctttga tgttgtcctg 360 ttctgttacc ataatagttc tagcgacaaa acaaagatgg tcgggaaggc taggaatggg 420 atcggccttg aggaccttgc cagcacagtt aggagctact gttctcttcg cagcttttgt 480 tcaaaatatg ctccagtaat ttggaattac gggataagca atgatctacc accagctaac 540 tggcaaaggc gcaaggttgt ggaaggtgcc aaattcgcag cttttgactt ttttgaggct 600 gtcactagcg aagctgcact acaaccagtg gaggggcttg ttagaaatcc cacagacaag 660 gagatgactg ccggagcatc ccttaaagag atcagcctga tgcgcgatga aatccggaga 720 ggtaccagtt ccactttaat gactgaagtg actggaggca ggactggcca aattcaacct 780 atcaagaaaa ttggtggtga tgaatga 807 //