ID   JX444576; SV 1; linear; genomic DNA; STD; VRL; 1038 BP.
XX
AC   JX444576;
XX
DT   03-OCT-2012 (Rel. 114, Created)
DT   28-MAR-2013 (Rel. 116, Last updated, Version 2)
XX
DE   Watermelon chlorotic stunt virus strain WmCSV-JOR AC4 gene, partial cds;
DE   and AV2 gene, complete cds.
XX
KW   .
XX
OS   Watermelon chlorotic stunt virus
OC   Viruses; Geminiviridae; Begomovirus.
XX
RN   [1]
RP   1-1038
RA   Haj Ahmad F., Odeh W., Anfoka G.;
RT   "First Report on the Association of Squash leaf curl virus and Watermelon
RT   chlorotic stunt virus with Tomato Yellow Leaf Curl Disease";
RL   Plant Dis. 97(3):428-428(2013).
XX
RN   [2]
RP   1-1038
RA   Anfoka G.H., Haj Ahmad F.W.;
RT   ;
RL   Submitted (30-JUL-2012) to the INSDC.
RL   Department of Biotechnology, Faculty of Agricultural Technology, Al-Balqa'
RL   Applied University, Al-Salt 19117, Jordan
XX
DR   MD5; d4869944e31b423aef1e74256cbb0ade.
XX
CC   ##Assembly-Data-START##
CC   Assembly Method       :: CLC Main Worbench v. 6.6.2
CC   Sequencing Technology :: Sanger dideoxy sequencing
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1038
FT                   /organism="Watermelon chlorotic stunt virus"
FT                   /segment="DNA-A"
FT                   /host="tomato"
FT                   /strain="WmCSV-JOR"
FT                   /mol_type="genomic DNA"
FT                   /country="Jordan"
FT                   /collection_date="2011"
FT                   /db_xref="taxon:35341"
FT   CDS             complement(<1..65)
FT                   /codon_start=1
FT                   /product="AC4"
FT                   /db_xref="UniProtKB/TrEMBL:K0E2F7"
FT                   /protein_id="AFT90673.1"
FT                   /translation="MGNLISMCSCSSPERSPSQTIA"
FT   CDS             503..862
FT                   /codon_start=1
FT                   /product="AV2"
FT                   /db_xref="GOA:K0E1L1"
FT                   /db_xref="InterPro:IPR002511"
FT                   /db_xref="InterPro:IPR005159"
FT                   /db_xref="UniProtKB/TrEMBL:K0E1L1"
FT                   /protein_id="AFT90672.1"
FT                   /translation="MWDPLLNDFPESVHGFRCMLAVKYLQAVESTYEPNTLGHELIRDL
FT                   ILVLRARDYGEATRRYSHFHSRFEGSSKTELRQPLHEPCSCPHCPRHKQASTMGQQAHV
FT                   SKAHDVQDVSKPRCP"
XX
SQ   Sequence 1038 BP; 260 A; 239 C; 274 G; 265 T; 0 other;
     gcgattgtct gtgatggtga tctttccggc gaactgcagg agcacatgga gatgaggttc        60
     cccattctgg tgcagttctc tgcacacctt gacgtatttt aagttcgacg gaagggagag       120
     gccgactaaa aaggaaagta gctcttcttt ggatagagag cacctgggat atgtgaggaa       180
     aatgtttttc gcttgtattc taaaacgggg aggccttcat gttgaccagt caacttggag       240
     acacccccca gatcactaac ccctgtatat tggagactgg agacaatata tagaagtagt       300
     aagaggtact actaggattt tgacacgtag cgggcatcct ataatattac cggatgcccg       360
     cggagcccaa aagtgacccc acaggacacg tgcaccaata aaattgcgtg ctttgaggta       420
     agttagctgg aaatggggtt ttgaaagcga caagtcatac gagtcctatt tattctgctg       480
     ctgcggatca acttttgtca gtatgtggga tccattgctt aatgactttc ccgagtcggt       540
     tcacggcttt cggtgtatgc tagctgtcaa gtacttgcag gccgttgaat cgacctacga       600
     gcccaatact ttgggccacg aattgatccg cgatctgatt cttgtcctcc gggcccgtga       660
     ttatggcgaa gcgaccagga gatattctca tttccactcc cgtttcgaag gttcgtcgaa       720
     aactgaactt cgacagcccc tacatgagcc gtgctcttgc ccccactgtc ctcgtcacaa       780
     gcaagcgtcg acaatgggcc aacaggccca tgtatcgaaa gcccatgatg tacaggatgt       840
     atcgaagccc agatgtccct aaagggctgc gaaggcccgt gcaaagttca gtcgtacgaa       900
     caacgtgacg acgttaaaca caccggtatc gtccggtgtg tcagtgatgt tactaggggg       960
     agtggaatca ctcatcgtgt cggaaagagg ttttgtgtga agtctatatc ctttctgggc      1020
     aagatctgga tggatgag                                                    1038
//