ID JQ990967; SV 1; linear; genomic DNA; STD; VRL; 405 BP. XX AC JQ990967; XX DT 05-FEB-2013 (Rel. 115, Created) DT 05-FEB-2013 (Rel. 115, Last updated, Version 1) XX DE Tomato yellow leaf curl virus isolate KQT AC3 protein gene, complete cds. XX KW . XX OS Tomato yellow leaf curl virus OC Viruses; Geminiviridae; Begomovirus. XX RN [1] RP 1-405 RA Ma D.Y., Cao Q., Ma L.J., Li G.Z., Duan X.D., Mairemuguli K.; RT "The areal distribution of biotypes of bemisia tabaci and detection of RT Tomato yellow leaf curl virus (TYLCV) in Xinjiang province"; RL Unpublished. XX RN [2] RP 1-405 RA Ma D.Y., Cao Q., Ma L.J., Li G.Z., Duan X.D., Mairemuguli K.; RT ; RL Submitted (30-APR-2012) to the INSDC. RL College of Agronomy, Xin Jiang Agricultural University, No. 42 Nan Chang RL Road, Urumqi, Xin Jiang 830052, China XX DR MD5; 610499aeade60c64b921c9471037308f. XX CC ##Assembly-Data-START## CC Sequencing Technology :: Sanger dideoxy sequencing CC ##Assembly-Data-END## XX FH Key Location/Qualifiers FH FT source 1..405 FT /organism="Tomato yellow leaf curl virus" FT /host="tomato" FT /isolate="KQT" FT /mol_type="genomic DNA" FT /country="China" FT /collection_date="24-Mar-2012" FT /PCR_primers="fwd_name: TYLCV-F, fwd_seq: FT acgcatgcctctaatccagtgta, rev_name: TYLCV-R, rev_seq: FT ccaataaggcgtaagcgtgtagac" FT /db_xref="taxon:10832" FT CDS complement(1..405) FT /codon_start=1 FT /product="AC3 protein" FT /db_xref="GOA:L7X9B1" FT /db_xref="InterPro:IPR000657" FT /db_xref="UniProtKB/TrEMBL:L7X9B1" FT /protein_id="AGD80634.1" FT /translation="MDSRTGELITAPQAENGVFIWEINNPLYFKITEHSQRPFLMNHDI FT ISIQIRFKHNIRKILGIHKCFLNFRIWTTLQPQTGRFLRVFRYQVLKYLDSLGVISINN FT VIRAVDHVLYDVLENTINVTETHDIKYKFY" XX SQ Sequence 405 BP; 121 A; 69 C; 73 G; 142 T; 0 other; ttaataaaat ttatatttta tatcatgagt ttctgttaca tttattgtgt tttcaagtac 60 atcatacaat acatgatcaa ctgctctgat tacattgtta attgaaatta caccaagact 120 atctaaatac ttaagaacct gatatctaaa tactcttaag aaacgaccag tctgaggctg 180 taatgtcgtc caaattcgga agttgagaaa acatttgtga atccccaata tcttcctgat 240 gttgtgtttg aatcttatct gaatggaaat gatgtcgtgg ttcattagaa atggcctctg 300 gctgtgttct gttatcttga aatagagggg attgtttatc tcccagataa aaacgccatt 360 ctctgcttga ggagcagtga tgagttcccc tgtgcgtgaa tccat 405 //