ID JQ013960; SV 1; linear; genomic RNA; STD; VRL; 1092 BP. XX AC JQ013960; XX DT 22-FEB-2012 (Rel. 111, Created) DT 22-FEB-2012 (Rel. 111, Last updated, Version 1) XX DE Citrus leaf blotch virus strain Actinidia clone 1K coat protein gene, DE complete cds. XX KW . XX OS Citrus leaf blotch virus OC Viruses; Riboviria; Tymovirales; Betaflexiviridae; Trivirinae; Citrivirus. XX RN [1] RP 1-1092 RA Chavan R.R., Blouin A.G., Cohen D., Pearson M.N.; RT "Characterization of complete genome of a novel virus infecting Actinidia RT chinensis (isolate M3-A) from China resembling Citrus leaf blotch virus"; RL Unpublished. XX RN [2] RP 1-1092 RA Chavan R.R., Pearson M.N.; RT ; RL Submitted (04-NOV-2011) to the INSDC. RL School of Biological Sciences, University of Auckland, Thomas Building, RL Private Bag 92019, Symonds Street, Auckland, North Island 1142, New Zealand XX DR MD5; 4200a8fba1f7364038260d8837aecadd. XX FH Key Location/Qualifiers FH FT source 1..1092 FT /organism="Citrus leaf blotch virus" FT /strain="Actinidia" FT /isolate="F1-N" FT /mol_type="genomic RNA" FT /country="China" FT /isolation_source="Nicotiana benthamiana inoculated with FT leaf sap of Actinidia chinensis" FT /collection_date="01-May-2004" FT /identified_by="Ramesh R. Chavan and Mike N. Pearson" FT /clone="1K" FT /db_xref="taxon:129141" FT CDS 1..1092 FT /codon_start=1 FT /product="coat protein" FT /note="ORF 3" FT /db_xref="GOA:H6W0Z1" FT /db_xref="InterPro:IPR000052" FT /db_xref="UniProtKB/TrEMBL:H6W0Z1" FT /protein_id="AFA43545.1" FT /translation="MKITNDNATTINYWLAIVEPFLTSDEERNSDDIIQKFRAVVAEHG FT DTEEVDPEVFFAIFSILATKYGRVYSKKVEELNESLKAAILAGAEAEDLINKLKDISQR FT YASQIEITADRELQLENLRKKGHEQPLTGSGSSEPAHNEPAHTPQLHVVNDLQQFYIPF FT NEYPSLTQSIGTSDVANDEHLRRVQLTLKITDTKVFSRTGFEFAISCGSRSTSDKDPYD FT GIIKISGKSHMRKDIAYAIRTSGITVRQFCAAFANLYWNFNLARNTPPENWRKKGFTEG FT TKFAAFDFFYAVGSNAAIPTEADGSVRLIRPPTNEENEANSAMRYADIYEQNSKTAGHV FT TSSPLYNKGSSYESKNKAKLLEM" XX SQ Sequence 1092 BP; 369 A; 205 C; 251 G; 267 T; 0 other; atgaaaatca ccaatgacaa tgccacaacc atcaactatt ggttagccat agttgaacca 60 tttctcacat ctgatgagga gagaaattct gatgacatca ttcaaaaatt cagagccgtg 120 gtggctgagc atggagatac ggaagaagtg gatcctgaag ttttctttgc cattttctcc 180 atccttgcca caaaatatgg tagagtttac tcaaaaaaag ttgaggaatt gaatgagtca 240 ctcaaggctg caatattggc aggagctgag gcagaggatt tgataaataa acttaaggat 300 atttcccaaa ggtatgcctc acagattgaa ataacagcag atagggaatt gcagctggag 360 aatttgagga aaaaagggca tgaacaaccg ctgaccggca gtggatcttc tgaaccggca 420 cacaatgagc cagcacatac tccacagctg catgtggtga acgatttgca gcagttctac 480 ataccattta atgaatatcc aagcctgacg caatcgatcg gtacctccga tgttgcaaat 540 gatgagcatc tcagaagagt gcagcttaca ctcaaaatca cagacacaaa ggttttctca 600 agaactggat ttgagtttgc gataagctgt ggatcaagga gcacatcaga caaggaccca 660 tatgatggta tcattaaaat aagtgggaaa agtcacatga gaaaagatat tgcatatgca 720 ataagaacct cagggattac agtgaggcaa ttttgtgccg cctttgcaaa tttgtactgg 780 aatttcaatc ttgccaggaa cacacctcct gaaaactgga ggaagaaggg atttactgag 840 ggaactaaat ttgcggcttt tgactttttc tacgcggtag gcagtaatgc agcaattcca 900 acagaagctg atggaagtgt tagattaatc aggcctccaa cgaatgagga gaatgaggcc 960 aattctgcta tgaggtatgc tgacatatat gagcaaaatt ccaagactgc tggacatgtg 1020 acctcgagtc cattgtacaa caagggtagc agttatgaaa gtaaaaataa agctaaactc 1080 ttagaaatgt ag 1092 //