ID JN849001; SV 1; linear; genomic RNA; STD; VRL; 582 BP. XX AC JN849001; XX DT 05-FEB-2012 (Rel. 111, Created) DT 05-APR-2012 (Rel. 112, Last updated, Version 2) XX DE Apple chlorotic leaf spot virus isolate G4 coat protein gene, complete cds. XX KW . XX OS Apple chlorotic leaf spot virus OC Viruses; Riboviria; Tymovirales; Betaflexiviridae; Trivirinae; Trichovirus. XX RN [1] RP 1-582 RX DOI; 10.1007/s00705-011-1195-5. RX PUBMED; 22278708. RA Niu F., Pan S., Wu Z., Jiang D., Li S.; RT "Complete nucleotide sequences of the genomes of two isolates of apple RT chlorotic leaf spot virus from peach (Prunus persica) in China"; RL Arch. Virol. 157(4):783-786(2012). XX RN [2] RP 1-582 RA Niu F., Pan S., Wu Z., Li S.; RT ; RL Submitted (12-OCT-2011) to the INSDC. RL State Key Laboratory of Biology of Plant Diseases and Insect Pests, RL Institute of Plant Protection, Chinese Academy of Agricultural Sciences, RL Yuanmingyuan Road West 2, Haidian, Beijing 100193, China XX DR MD5; 74b89b9b5d19167e207183a5196c34f7. XX FH Key Location/Qualifiers FH FT source 1..582 FT /organism="Apple chlorotic leaf spot virus" FT /isolate="G4" FT /mol_type="genomic RNA" FT /country="China" FT /collected_by="Shifang Li" FT /collection_date="05-Jul-2011" FT /clone="G4-1" FT /db_xref="taxon:12175" FT CDS 1..582 FT /codon_start=1 FT /product="coat protein" FT /db_xref="GOA:H6VNS6" FT /db_xref="InterPro:IPR008879" FT /db_xref="UniProtKB/TrEMBL:H6VNS6" FT /protein_id="AEZ03879.1" FT /translation="MAAVLNLQLKVDADLKAFLVAEGRPLHGKTGAILEQMLESIFANI FT AIQGTSEQTEFLDLMVEVKSMEDQKVIGSYNLKEIVNMIKAFRTTSSDPNINNMTFRQV FT CEAFAPEARNGLVKLKYKGVFTNLFTTMPEVGSKYPELMFDFNKGLNMFIMNKAQQKVI FT TNMNRRLLQTEFAKSENEAKLSSVSTDLCI" XX SQ Sequence 582 BP; 180 A; 120 C; 145 G; 137 T; 0 other; atggcagcag ttctgaatct gcagttaaag gtggacgccg atctgaaagc gttcctggtc 60 gcagaaggca gaccccttca tggaaagaca ggggcaatcc tggaacagat gttggagtcc 120 atcttcgcga atattgcaat ccaagggacg tcagagcaga cagagttcct ggacttgatg 180 gtggaagtga aatcaatgga ggaccagaag gtgataggat cgtacaatct gaaggagatc 240 gtcaatatga tcaaagcctt caggactacc tcttcagatc cgaacatcaa caacatgacc 300 ttccggcaag tatgtgaggc gtttgcacct gaggcaagaa atgggttggt caaactcaag 360 tacaaagggg ttttcacaaa ccttttcact acaatgccag aggttgggag caaatacccg 420 gagctgatgt ttgattttaa taaaggcctc aacatgttca tcatgaacaa ggctcagcaa 480 aaggtaataa ccaatatgaa ccgtcgtctt ttacagactg aatttgcaaa gagtgaaaat 540 gaggcgaaac tctcgtctgt ctcaactgat ctttgcattt ag 582 //