ID JN848981; SV 1; linear; genomic RNA; STD; VRL; 582 BP. XX AC JN848981; XX DT 05-FEB-2012 (Rel. 111, Created) DT 05-APR-2012 (Rel. 112, Last updated, Version 2) XX DE Apple chlorotic leaf spot virus isolate HB2 coat protein gene, complete DE cds. XX KW . XX OS Apple chlorotic leaf spot virus OC Viruses; Riboviria; Tymovirales; Betaflexiviridae; Trivirinae; Trichovirus. XX RN [1] RP 1-582 RX DOI; 10.1007/s00705-011-1195-5. RX PUBMED; 22278708. RA Niu F., Pan S., Wu Z., Jiang D., Li S.; RT "Complete nucleotide sequences of the genomes of two isolates of apple RT chlorotic leaf spot virus from peach (Prunus persica) in China"; RL Arch. Virol. 157(4):783-786(2012). XX RN [2] RP 1-582 RA Niu F., Pan S., Wu Z., Li S.; RT ; RL Submitted (12-OCT-2011) to the INSDC. RL State Key Laboratory of Biology of Plant Diseases and Insect Pests, RL Institute of Plant Protection, Chinese Academy of Agricultural Sciences, RL Yuanmingyuan Road West 2, Haidian, Beijing 100193, China XX DR MD5; 205ed25c26b6f1a9a8f2e92e28d8259e. XX FH Key Location/Qualifiers FH FT source 1..582 FT /organism="Apple chlorotic leaf spot virus" FT /isolate="HB2" FT /mol_type="genomic RNA" FT /country="China" FT /collected_by="Shifang Li" FT /collection_date="03-May-2011" FT /clone="HB2-1" FT /db_xref="taxon:12175" FT CDS 1..582 FT /codon_start=1 FT /product="coat protein" FT /db_xref="GOA:H6VNQ6" FT /db_xref="InterPro:IPR008879" FT /db_xref="UniProtKB/TrEMBL:H6VNQ6" FT /protein_id="AEZ03859.1" FT /translation="MAATLNLQLKVDKDLRVFLAEDNRPLHGKTGGTVELILESIFANI FT AIQGTSEQTEFLDVEVEVKTFGDPTVLQRYNLKTVVELIKLFRTTSSDKNINTLTFRQI FT CEAFAPEARDGLVKLKMIGVLTNLYKTMPEVGNKYPELMFDFNKGLNPMLMNKTQRVVV FT TNLNRRLLQTEFAKSENEAKIASVSNDLCI" XX SQ Sequence 582 BP; 180 A; 123 C; 143 G; 136 T; 0 other; atggccgcaa ccttgaacct acagctgaag gtggacaagg acctgagggt ttttctggca 60 gaggacaatc gtcctcttca tggaaagaca gggggaacag tggaactgat actggagtcc 120 atcttcgcaa acatcgcaat tcaaggaacg tcagagcaaa cggaattcct ggacgtggaa 180 gtcgaagtga agacatttgg ggatcccaca gtgctgcaga ggtacaatct gaagacagtc 240 gtggagctga tcaagctttt tcggaccaca tcttcggaca agaacatcaa caccctaacc 300 tttaggcaaa tatgcgaagc ctttgctccg gaggccagag atgggctggt taaactcaag 360 atgattggcg ttctgaccaa tctgtacaaa acaatgccag aggtgggtaa caaatatcct 420 gagctcatgt ttgatttcaa caaggggctt aatccaatgc taatgaataa aacccaaagg 480 gtagtcgtta ccaacctcaa tcggcgtctt ttacaaactg aatttgcaaa gagtgaaaat 540 gaagcaaaga ttgcttcagt ttctaacgat ttgtgcattt ag 582 //