ID EU677426; SV 1; linear; genomic DNA; STD; VRL; 540 BP. XX AC EU677426; XX DT 02-AUG-2008 (Rel. 96, Created) DT 23-MAR-2009 (Rel. 100, Last updated, Version 2) XX DE Tomato yellow leaf curl virus isolate Orzuiyeh precoat protein (V2) gene, DE complete cds; and coat protein (V1) gene, partial cds. XX KW . XX OS Tomato yellow leaf curl virus OC Viruses; Geminiviridae; Begomovirus. XX RN [1] RP 1-540 RX DOI; 10.1007/s11262-008-0310-5. RX PUBMED; 19112612. RA Fazeli R., Heydarnejad J., Massumi H., Shaabanian M., Varsani A.; RT "Genetic diversity and distribution of tomato-infecting begomoviruses in RT Iran"; RL Virus Genes 38(2):311-319(2009). XX RN [2] RP 1-540 RA Heydarnejad J., Fazeli R., Massumi H.; RT ; RL Submitted (23-APR-2008) to the INSDC. RL Plant Protection Department, Shahid Bahonar University of Kerman, 22 Bahman RL Ave, Kerman, Kerman 7616914111, Iran XX DR MD5; 57a8979bd1680bdf5af052b5f69a83bd. XX FH Key Location/Qualifiers FH FT source 1..540 FT /organism="Tomato yellow leaf curl virus" FT /host="Lycopersicon esculentum" FT /isolate="Orzuiyeh" FT /mol_type="genomic DNA" FT /country="Iran:Kerman, Orzuiyeh" FT /db_xref="taxon:10832" FT gene 154..504 FT /gene="V2" FT CDS 154..504 FT /codon_start=1 FT /gene="V2" FT /product="precoat protein" FT /db_xref="GOA:B4YSZ9" FT /db_xref="InterPro:IPR002511" FT /db_xref="InterPro:IPR005159" FT /db_xref="UniProtKB/TrEMBL:B4YSZ9" FT /protein_id="ACF04178.1" FT /translation="MWDPLLNEFPESVHGFRCMLAIKYLQSVEETYEPNTLGHDLIRDL FT ISVVRARDYVEATRRYNHFHARLEGSPKAELRQPIQQPCCCPHCPRHKQATIMDVQAHV FT SKAQNIQNVSKP" FT gene 314..>540 FT /gene="V1" FT CDS 314..>540 FT /codon_start=1 FT /gene="V1" FT /product="coat protein" FT /note="CP" FT /db_xref="GOA:B4YT00" FT /db_xref="InterPro:IPR000263" FT /db_xref="UniProtKB/TrEMBL:B4YT00" FT /protein_id="ACF04179.1" FT /translation="MSKRPGDIIISTPVSKVRRRLNFDSPYSNRAAVPIVQGTNKRRSW FT TYRPMYRKPRIYRMYRSPDVPRGCEGPCKV" XX SQ Sequence 540 BP; 138 A; 134 C; 116 G; 152 T; 0 other; taatattacc ggatggccgc gcctttcttt ttatgtggtc cccacgaggg ttccacagac 60 gtcgctatca accaatcaaa ttgcatcctc aaacgttata taagtgttca tatgtcttta 120 tatacttggt ccccaagtat tttgtcttgc attatgtggg acccccttct aaatgagttt 180 cctgaatctg ttcacggatt tcgttgtatg ttagctatta aatatttgca gtccgttgag 240 gaaacttacg agcccaatac attgggccac gatttaatta gggatcttat atctgttgta 300 agggcccgtg actatgtcga agcgaccagg cgatataatc atttccacgc ccgtctcgaa 360 ggttcgccga aggctgaact tcgacagccc atacagcaac cgtgctgctg tccccattgt 420 ccaaggcaca aacaagcgac gatcatggac gtacaggccc atgtatcgaa agcccagaat 480 atacagaatg tatcgaagcc ctgatgttcc ccgtggatgt gaaggccctt gcaaagtcca 540 //