ID DQ302758; SV 1; linear; genomic RNA; STD; VRL; 555 BP. XX AC DQ302758; XX DT 15-JAN-2006 (Rel. 86, Created) DT 15-JAN-2006 (Rel. 86, Last updated, Version 1) XX DE Sugarcane yellow leaf virus capsid protein gene, partial cds; and putative DE movement protein p17 gene, complete cds. XX KW . XX OS Sugarcane yellow leaf virus OC Viruses; Riboviria; Luteoviridae; Polerovirus. XX RN [1] RP 1-555 RA Gao S.J., Guo J.L., Wang W.Z., Meng Y., Chen Y.Q., Chen R.K.; RT "Molecular characterization of sugarcane yellow leaf virus of sugarcane of RT Chinese isolate"; RL Unpublished. XX RN [2] RP 1-555 RA Guo J.L., Gao S.J., Meng Y., Chen Y.Q., Chen R.K.; RT ; RL Submitted (23-NOV-2005) to the INSDC. RL Key Laboratory of Eco-physiology & Genetics Improvement for Sugarcane, RL Ministry of Agriculture, Fujian Agriculture and Forestry University, RL Fuzhou, Fujian 350002, China XX DR MD5; 85b11b5177396b88f387f479b1a3eccd. XX FH Key Location/Qualifiers FH FT source 1..555 FT /organism="Sugarcane yellow leaf virus" FT /host="Saccharum sp. cultivar FN96-0907" FT /mol_type="genomic RNA" FT /country="China" FT /db_xref="taxon:94290" FT CDS <1..>555 FT /codon_start=1 FT /product="capsid protein" FT /db_xref="GOA:Q2LH19" FT /db_xref="InterPro:IPR001517" FT /db_xref="InterPro:IPR029053" FT /db_xref="UniProtKB/TrEMBL:Q2LH19" FT /protein_id="ABC61125.1" FT /translation="RSRRNVRRRANRRRQTRPVVVVRAPPGPRRVRRRRARVGGNAVRG FT PGGRSNRDVLTFTVDDLKANSTGILKFGPNLSQYAAFNNGLLKAYHEYKITSLTIQYNS FT CSSDATPGAIALEVDTSCSQTTTGSKITSFPVKRNAKKVFPAPFIRGKDFMTTSADQFW FT LLYKGNGDSSLAGQFVCRFECL" FT CDS 14..466 FT /codon_start=1 FT /product="putative movement protein p17" FT /db_xref="InterPro:IPR001964" FT /db_xref="UniProtKB/TrEMBL:Q9WI47" FT /protein_id="ABC61124.1" FT /translation="MSEDALTVVDRLGQWSWSGLPQDLDEYDDVEHVLEETLCEDREEE FT ATGMFSLSRLTISKPTQPGSSNSDRTYLSTQRSTMAYSKPTMSIKSQVSLFSITHAPPT FT QLQVQSHLKWIHPAPKQQQAPRLLASPSRGTPRKSSRPPSSGGKIS" XX SQ Sequence 555 BP; 153 A; 153 C; 135 G; 114 T; 0 other; cgctcacgaa ggaatgtcag aagacgcgct aaccgtcgta gacagactcg gccagtggtc 60 gtggtccggg ctcccccagg acctagacga gtacgacgac gtagagcacg tgttggagga 120 aacgctgtgc gaggaccggg aggaagaagc aaccgggatg ttctcacttt cacggttgac 180 gatctcaaag ccaactcaac cgggatcctc aaattcggac cgaacttatc tcagtacgca 240 gcgttcaaca atggcttact caaagcctac catgagtata aaatcacaag tctcactatt 300 cagtataact catgctcctc cgacgcaact ccaggtgcaa tcgcacttga agtggataca 360 tcctgctccc aaacaacaac aggctccaag attactagct tccccgtcaa gaggaacgcc 420 aagaaagtct tcccggcccc cttcatcagg gggaaagatt tcatgactac gtcagctgac 480 cagttttggt tgctgtacaa agggaatgga gactcgagcc tagcaggaca attcgtctgc 540 cgatttgaat gcctt 555 //