ID   D00721; SV 1; linear; genomic RNA; STD; VRL; 457 BP.
XX
AC   D00721;
XX
DT   04-SEP-1992 (Rel. 33, Created)
DT   15-DEC-2007 (Rel. 94, Last updated, Version 8)
XX
DE   Chicory yellow mottle virus satellite RNA gene for hypothetical protein,
DE   complete cds.
XX
KW   .
XX
OS   Chicory yellow mottle virus satellite RNA
OC   Viruses; Satellites; RNA satellites; Single stranded RNA satellites;
OC   unclassified Single stranded RNA satellites.
XX
RN   [1]
RP   1-457
RX   PUBMED; 1698918.
RA   Rubino L., Tousignant M.E., Steger G., Kaper J.M.;
RT   "Nucleotide sequence and structural analysis of two satellite RNAs
RT   associated with chicory yellow mottle virus";
RL   J. Gen. Virol. 71:1897-1903(1990).
XX
DR   MD5; d695854b730be26f728361f9259419a8.
DR   RFAM; RF00173; Hairpin.
XX
CC   These data kindly submitted in computer readable form by:
CC   Luisa Rubino
CC   Consiglio Nazionale delle Ricerche
CC   Via Amendola 165/A
CC   70126 Bari
CC   Italy
CC   The plus strand is shown here.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..457
FT                   /organism="Chicory yellow mottle virus satellite RNA"
FT                   /mol_type="genomic RNA"
FT                   /note="satellite RNA S1"
FT                   /db_xref="taxon:192022"
FT   misc_structure  1..46
FT                   /note="hammerhead structure"
FT   regulatory      complement(39..54)
FT                   /note="self-cleavage consensus sequence"
FT                   /regulatory_class="other"
FT   CDS             224..376
FT                   /codon_start=1
FT                   /product="hypothetical protein"
FT                   /note="ORF"
FT                   /db_xref="UniProtKB/TrEMBL:Q66094"
FT                   /protein_id="BAA00623.1"
FT                   /translation="MQTGANHTRMVPDNIPHMVCFPGALRCCMCKSGSASRSWATVLLG
FT                   TRFSI"
FT   regulatory      complement(255..306)
FT                   /note="self-cleavage consensus sequence"
FT                   /regulatory_class="other"
FT   misc_structure  450..457
FT                   /note="hammerhead structure"
XX
SQ   Sequence 457 BP; 94 A; 118 C; 130 G; 115 T; 0 other;
     gccagacgtg gacccggcct gatgagtccg aaaggacgaa acagtactgc gctaagaggt        60
     gagactactt caatcctctt atgaccttcc ctgctgatgt tacctgggat ttatcctgtg       120
     gtaagggtat aggacggtcc taccatacgt gctccacgag tgtattcctc gtgatgagcg       180
     gtgggggggt cccgttatgg ggtccagccg gcgacgcatt tctatgcaga ccggtgcaaa       240
     ccacacgcgt atggtgccag ataatatacc acacatggtg tgtttccctg gcgcgcttcg       300
     ctgttgtatg tgtaagtcgg gctcagcctc ccgcagctgg gcgacggttc tacttggtac       360
     ccgattttca atttgagagt tgggctacca acggaacttt cgtccgtgcg gtagggtggg       420
     cttgccctga aaacaaccac ctatcaagat tactgtc                                457
//