ID   AY850931; SV 1; linear; genomic RNA; STD; VRL; 1295 BP.
XX
AC   AY850931;
XX
DT   19-APR-2005 (Rel. 83, Created)
DT   11-MAR-2007 (Rel. 91, Last updated, Version 4)
XX
DE   Alternanthera mosaic virus AltMV-SP triple gene block 2 protein (TGB2),
DE   triple gene block 3 protein (TGB3), and coat protein (CP) genes, complete
DE   cds.
XX
KW   .
XX
OS   Alternanthera mosaic virus
OC   Viruses; Riboviria; Tymovirales; Alphaflexiviridae; Potexvirus.
XX
RN   [1]
RP   1-1295
RA   Hammond J., Reinsel M.D., Maroon-Lango C.J.;
RT   "Identification of potexvirus isolates from creeping phlox and trailing
RT   portulaca as strains of Alternanthera mosaic virus, and comparison of the
RT   3-terminal portion of the viral genomes";
RL   Acta Hortic. 722:71-77(2006).
XX
RN   [2]
RP   1-1295
RX   DOI; 10.1007/s00705-005-0646-2.
RX   PUBMED; 16211329.
RA   Hammond J., Reinsel M.D., Maroon-Lango C.J.;
RT   "Identification and full sequence of an isolate of Alternanthera mosaic
RT   potexvirus infecting Phlox stolonifera";
RL   Arch. Virol. 151(3):477-493(2006).
XX
RN   [3]
RP   1-1295
RA   Hammond J., Reinsel M.D., Maroon-Lango C.J.;
RT   ;
RL   Submitted (09-DEC-2004) to the INSDC.
RL   Floral and Nursery Plants Research Unit, United States National Arboretum,
RL   USDA-ARS, 10300 Baltimore Avenue, Beltsville, MD 20705, USA
XX
DR   MD5; eeee5f98d9b3a17960d404b04a0abe2e.
DR   EuropePMC; PMC3560364; 23386854.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1295
FT                   /organism="Alternanthera mosaic virus"
FT                   /host="Phlox stolonifera cv. Sherwood Purple"
FT                   /isolate="AltMV-SP"
FT                   /mol_type="genomic RNA"
FT                   /country="USA:Maryland"
FT                   /db_xref="taxon:85454"
FT   gene            44..376
FT                   /gene="TGB2"
FT   CDS             44..376
FT                   /codon_start=1
FT                   /gene="TGB2"
FT                   /product="triple gene block 2 protein"
FT                   /note="12 kDa protein"
FT                   /db_xref="GOA:Q52Z63"
FT                   /db_xref="InterPro:IPR001896"
FT                   /db_xref="UniProtKB/TrEMBL:Q52Z63"
FT                   /protein_id="AAX86022.1"
FT                   /translation="MSGLPHSLTPPADYSKPVLAAAVGVSLALVINSFLVYRLPSPGDN
FT                   IHQLPFGGSYRDGTKSIHYNSPRAQSQISGASPFLIILILSALIYALSCRGGHHRARLH
FT                   RCPCCS"
FT   gene            312..503
FT                   /gene="TGB3"
FT   CDS             312..503
FT                   /codon_start=1
FT                   /gene="TGB3"
FT                   /product="triple gene block 3 protein"
FT                   /note="7 kDa protein"
FT                   /db_xref="InterPro:IPR003411"
FT                   /db_xref="UniProtKB/TrEMBL:Q52Z62"
FT                   /protein_id="AAX86023.1"
FT                   /translation="MPYLVEAAITVLACIGVLAALRPGSHPCTILLTGHSATISGNCGP
FT                   VAPETIRALGDYLTGLRF"
FT   gene            546..1169
FT                   /gene="CP"
FT   CDS             546..1169
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /db_xref="GOA:Q52Z61"
FT                   /db_xref="InterPro:IPR000052"
FT                   /db_xref="UniProtKB/TrEMBL:Q52Z61"
FT                   /protein_id="AAX86024.1"
FT                   /translation="MSTPFPQVTQEQMNAFTPHTTSNLLPSPEQLTTIANLLVAAKVPA
FT                   ASTTTIALELVNFCYDNGSSTYTAVVGPSSLAEVSLSQVANIVKASGTSLRKFCRFFAP
FT                   IIWNLRTDKTPPANWEANGFKPTEKFAAFDFFDGVENPAAMQPPGGLVRTPSQAERIAN
FT                   ATNKQVNLFQAAAQDNNFASNSAFITKGQLSSNSPTIQYLPPPE"
FT   variation       572
FT                   /gene="CP"
FT                   /replace="t"
FT   variation       854
FT                   /gene="CP"
FT                   /replace="g"
FT   3'UTR           1170..1295
FT   variation       1186
FT                   /replace="a"
XX
SQ   Sequence 1295 BP; 299 A; 406 C; 267 G; 323 T; 0 other;
     cacgctctgt acatcgctct cacccgccac aagaagtctc tccatgtccg ggctccccca        60
     ctccctgaca ccccccgccg attactctaa gccagtgctt gcagcagcag taggagttag       120
     tttagcttta gtaataaact ctttcttggt ctataggctt ccctcgcccg gggacaatat       180
     tcatcaactg ccctttggag gttcctaccg ggacggaact aagagcatcc actacaattc       240
     gcctagggcc cagagtcaga tctcaggtgc gtcaccgttc ctgataatcc tgatactctc       300
     agccctcatc tatgccctat cttgtagagg cggccatcac cgtgctcgct tgcataggtg       360
     tccttgctgc tcttaggcca gggtcccatc cttgcaccat tctgctaact ggacactctg       420
     cgaccattag cggaaactgt ggacctgtcg caccagagac catcagggct cttggagact       480
     acttaaccgg gcttaggttt tagcattagt ttgattatcc tattgtcatc ctagttgaag       540
     tcatcatgtc tacaccattt cctcaagtca cccaggaaca gatgaacgcc ttcactccac       600
     ataccacatc caatctcctt ccatcaccgg agcagttgac caccattgcc aacctcttgg       660
     ttgctgccaa ggtgcctgcc gcctcaacca cgaccattgc cctggagctt gttaacttct       720
     gttatgacaa tggctccagt acctacacag cggtggtggg cccttcttca cttgcagagg       780
     tctcactctc ccaggtcgct aacatcgtca aagcctcagg cacctctctc cgcaaattct       840
     gcagattctt tgctccaatc atctggaacc tcagaacaga caagacgccc ccagccaact       900
     gggaagccaa tgggttcaaa ccgacagaga agtttgcagc cttcgatttc ttcgatggag       960
     tggagaatcc ggcggccatg cagccaccag gagggttggt taggactccc agccaagcag      1020
     aaaggatcgc caacgccact aacaagcagg taaacctctt tcaggccgcg gcacaggata      1080
     ataacttcgc cagcaactct gcattcatca ccaagggcca attgtcctcc aactcaccaa      1140
     ccattcaata cctcccacca cctgagtgat ttctccaccc agtccgagcc cgttgttttc      1200
     gcaattttgt tggggctatc gagttttcaa aattgcttcc gcttctgtag acctaaatta      1260
     cagcctagtg tgcggtttaa tacctattta cgcac                                 1295
//