ID AM230638; SV 1; linear; genomic DNA; STD; VRL; 505 BP. XX AC AM230638; XX DT 30-JUN-2006 (Rel. 88, Created) DT 24-MAR-2007 (Rel. 91, Last updated, Version 2) XX DE Siegesbeckia yellow vein virus-[GD16] AV2 gene for precoat protein and DE partial AV1 gene for coat protein, isolate GD16 XX KW AV1 gene; AV2 gene; coat protein; precoat protein. XX OS Siegesbeckia yellow vein virus-[GD16] OC Viruses; Geminiviridae; Begomovirus. XX RN [1] RP 1-505 RA Zhou X.P.; RT ; RL Submitted (24-JAN-2006) to the INSDC. RL Zhou X.P., Zhejiang University, Institute of Biotechnology, NO. 268, RL Kaixuan Road, Hangzhou, Zhejiang, 310029, CHINA. XX RN [2] RX DOI; 10.1007/s00705-006-0896-7. RX PUBMED; 17187292. RA Wu J.B., Zhou X.P.; RT "Siegesbeckia yellow vein virus is a distinct begomovirus associated with a RT satellite DNA molecule"; RL Arch. Virol. 152(4):791-796(2007). XX DR MD5; 544353a03fb4db2fa70522ce246724fe. XX FH Key Location/Qualifiers FH FT source 1..505 FT /organism="Siegesbeckia yellow vein virus-[GD16]" FT /host="Sigesbeckia glabrescens" FT /isolate="GD16" FT /mol_type="genomic DNA" FT /country="China:Guangdong province" FT /db_xref="taxon:371406" FT CDS 113..469 FT /transl_table=1 FT /gene="AV2" FT /product="precoat protein" FT /db_xref="GOA:Q14RU6" FT /db_xref="InterPro:IPR002511" FT /db_xref="InterPro:IPR005159" FT /db_xref="UniProtKB/TrEMBL:Q14RU6" FT /protein_id="CAJ76452.1" FT /translation="MKMWDPLINEFPETVHGFRCMLAIKYLQAVQLTYSPDTVGYDLIR FT ELIRILRTKDYGQATCRYSHFHSRLQGTSEVELRQPLSQQCCCPNCPCHQQKEDMGQSA FT HVQKGQNVQDVQKP" FT CDS 279..>505 FT /transl_table=1 FT /gene="AV1" FT /product="coat protein" FT /db_xref="GOA:Q14RU5" FT /db_xref="InterPro:IPR000263" FT /db_xref="UniProtKB/TrEMBL:Q14RU5" FT /protein_id="CAJ76453.1" FT /translation="MAKRPADIVISTPASKVRRRLNFDSPYRSSAAAPTVLVTNKRRTW FT VNRPMYRKARMYRMYKSPDVPRGCEGPCKV" XX SQ Sequence 505 BP; 147 A; 112 C; 103 G; 143 T; 0 other; taatattacc tgtgggccgc caaaaaaatg atctagaccg ttgctcaaag ctaactaaaa 60 aatatccacg tatgcttttg tatatttaaa tgtatttcct tttgatttat atatgaaaat 120 gtgggatcct ttaattaacg aattccctga gaccgttcac ggttttagat gtatgcttgc 180 aataaaatat ctgcaagccg ttcaattgac gtactcccct gatacggtag gatacgattt 240 aattcgtgaa cttatacgta ttttacgtac taaggattat ggccaagcga cctgcagata 300 tagtcatttc cactcccgcc tccaaggtac gtcggaggtt gaacttcgac agcccctatc 360 gcagcagtgc tgctgcccca actgtccttg tcaccaacaa aaggaggaca tgggtcaatc 420 ggcccatgta cagaaaggcc agaatgtaca ggatgtacaa aagccctgat gttcctcgtg 480 gttgtgaagg accatgtaaa gtcca 505 //