ID AJ885155; SV 1; linear; mRNA; STD; VRL; 720 BP. XX AC AJ885155; XX DT 23-JUN-2005 (Rel. 84, Created) DT 23-JUN-2005 (Rel. 84, Last updated, Version 1) XX DE Rice yellow mottle virus mRNA for coat protein (ORF4 gene), isolate Tz14 XX KW coat protein; cp gene; ORF4. XX OS Rice yellow mottle virus OC Viruses; Riboviria; Solemoviridae; Sobemovirus. XX RN [1] RP 1-720 RA Fargette D.; RT ; RL Submitted (17-FEB-2005) to the INSDC. RL Fargette D., Dgpc, Ird, BP64501, 34394 Montpellier cedex 5, FRANCE. XX RN [2] RX DOI; 10.1111/j.1365-294X.2005.02578.x. RX PUBMED; 15910330. RA Traore O., Sorho F., Pinel A., Abubakar Z.; RT "Processes of diversification and dispersion of rice yellow mottle virus RT inferred from large-scale and high-resolution phylogeographical studies"; RL Mol. Ecol. 14(7):2097-2110(0). XX RN [3] RX DOI; 10.1111/j.1365-294X.2005.02578.x. RX PUBMED; 15910330. RA Traore O., Sorho F., Pinel A., Abubakar Z., Banwo O., Maley J., Hebrard E., RA Winter S., Sere Y., Konate G., Fargette D.; RT "Processes of diversification and dispersion of rice yellow mottle virus RT inferred from large-scale and high-resolution phylogeographical studies"; RL Mol. Ecol. 14(7):2097-2110(2005). XX DR MD5; 148eb5575fafc01e33720e9025aec9b5. XX FH Key Location/Qualifiers FH FT source 1..720 FT /organism="Rice yellow mottle virus" FT /isolate="Tz14" FT /mol_type="mRNA" FT /country="Tanzania" FT /db_xref="taxon:31744" FT CDS 1..720 FT /product="coat protein" FT /note="ORF4" FT /db_xref="GOA:Q805Q2" FT /db_xref="InterPro:IPR000937" FT /db_xref="InterPro:IPR029053" FT /db_xref="UniProtKB/TrEMBL:Q805Q2" FT /experiment="experimental evidence, no additional details FT recorded" FT /protein_id="CAI59702.1" FT /translation="MARKGKKISSNQGQQGKKKSRRPRGRSAEPQLQRAPVAQASRISG FT TVPGPLSSSSWPVHSVEFLMDFKRSATSAEATTFNCVPFNLPRVWSLARCYSLWKPTRW FT DVIYLPEVSAATAGSIEMCYLYDYADAIPSDTGKMSRTAGFVTSSVWYGAEGCHLLSGG FT TARNAVVASMDCSRVGWRRVTSSIPSSVDPNVVNTILPARLAVRSSIKPTVDDVPGKLY FT AIVSMVLRDPVDPTLNT" XX SQ Sequence 720 BP; 155 A; 190 C; 217 G; 158 T; 0 other; atggccagga agggcaagaa aatcagctcc aaccagggcc agcaaggaaa gaagaagagt 60 cggcgtcccc gtgggcgttc ggcggagccc cagcttcaac gggctccagt ggctcaggcc 120 tcccggatat ctgggacggt tcctggtcca ctatcttcta gctcctggcc ggtccactcc 180 gtggaattcc taatggattt taagcggagt gccacatcgg cagaagcgac gacattcaac 240 tgcgtgccgt ttaatctgcc tagggtgtgg agtcttgcgc gttgttactc actgtggaag 300 ccaacacggt gggatgtcat ctacctccct gaggttagtg cggcgacagc tggaagtatt 360 gagatgtgtt atctctacga ctatgctgac gccattccaa gtgacacggg caagatgagc 420 aggacggcgg gcttcgtcac ctctagcgtt tggtacggcg ctgagggctg ccatttgttg 480 agtggcggca cagcacgaaa tgccgtggtc gcctcgatgg attgctcgcg agtcggctgg 540 agacgcgtta ctagttcaat acctagtagc gtggatccca acgtcgtaaa caccatactg 600 ccagcaaggc tagctgtgcg gtcgtcgatc aaaccgacgg ttgatgatgt gccggggaaa 660 ctctacgcca tcgtcagtat ggtcctgcgg gatccggttg atccaacact caatacgtga 720 //