ID AJ866769; SV 1; linear; genomic RNA; STD; VRL; 336 BP. XX AC AJ866769; XX DT 07-DEC-2004 (Rel. 82, Created) DT 07-DEC-2004 (Rel. 82, Last updated, Version 1) XX DE Cucumber mosaic virus 2b gene for 2b protein, genomic RNA, specific host DE Lily Asiatic Hybrid cv. Romano XX KW 2b gene; 2b protein. XX OS Cucumber mosaic virus (cucumber mosaic cucumovirus) OC Viruses; Riboviria; Bromoviridae; Cucumovirus. XX RN [1] RP 1-336 RA Mahinghara B.K.; RT ; RL Submitted (26-NOV-2004) to the INSDC. RL Mahinghara B.K., Plant Virus Lab, Floriculture Division,, Institute of RL Himalayan Bioresource Tech., P.O. Box 6, Palampur, IHBT (CSIR), Himachal RL Pradesh, 176 061, INDIA. XX RN [2] RA Mahinghara B.K., Hallan V., Zaidi A.A.; RT "Variability in the genome of cucumber mosaic virus infecting lilies in RT India"; RL Unpublished. XX DR MD5; 0f6903d895a7e6c40d3837b13ba23033. XX FH Key Location/Qualifiers FH FT source 1..336 FT /organism="Cucumber mosaic virus" FT /host="Lily Asiatic Hybrid cv. Romano" FT /mol_type="genomic RNA" FT /country="India:Palampur" FT /db_xref="taxon:12305" FT CDS 1..336 FT /gene="2b" FT /product="2b protein" FT /db_xref="InterPro:IPR004946" FT /db_xref="UniProtKB/TrEMBL:Q5QQ47" FT /protein_id="CAI29760.1" FT /translation="MELNKVGAMTNVELQLARMVEAKKQRRRSHKQNRRERGHKSPSER FT ARSNLRLFRFLPFYQVDGSELTGSCRHVNVAELPESEASRLELSAEDHDFDDTDWFAGN FT EWAEGAF" XX SQ Sequence 336 BP; 93 A; 73 C; 99 G; 71 T; 0 other; atggaattga acaaagtagg tgcaatgaca aacgtcgaac tccaactggc tcgtatggtg 60 gaggcgaaga agcagagacg aaggtctcac aaacagaatc gacgggaacg aggtcacaaa 120 agtcccagcg agagagcgcg ttcaaatctc agactattcc gcttcctacc gttctatcaa 180 gtggatggtt cggaactgac agggtcatgc cgccatgtga acgtggcgga gttacccgag 240 tctgaggcct ctcgtttaga gttatcggcg gaagaccatg attttgacga tacagattgg 300 ttcgccggta acgaatgggc ggaaggtgct ttctga 336 //