ID AJ844584; SV 1; linear; genomic RNA; STD; VRL; 186 BP. XX AC AJ844584; XX DT 05-OCT-2004 (Rel. 81, Created) DT 05-OCT-2004 (Rel. 81, Last updated, Version 1) XX DE Carnation mottle virus p7 gene for Movement protein p7, genomic RNA, clone DE 390 XX KW p7 gene; Movement protein p7. XX OS Carnation mottle virus OC Viruses; Riboviria; Orthornavirae; Kitrinoviricota; Tolucaviricetes; OC Tolivirales; Tombusviridae; Procedovirinae; Alphacarmovirus; OC Alphacarmovirus dianthi. XX RN [1] RP 1-186 RA Raikhy G.; RT ; RL Submitted (04-OCT-2004) to the INSDC. RL Raikhy G., Plant Virus Lab, Floriculture Division, Institute of Himalayan RL Bioresource Tech., P.O. Box 6, Palampur, Himachal Pradesh - 176061, INDIA. XX RN [2] RA Raikhy G., Hallan V., Kulshrestha S., Sandhu G., Verma R.R., Zaidi A.A.; RT "Variability studies of movement protein and coat protein genes of RT different Carnation mottle virus Indian strains"; RL Unpublished. XX DR MD5; e16ad004d4acdb317ceda96e43a9adf3. XX FH Key Location/Qualifiers FH FT source 1..186 FT /organism="Carnation mottle virus" FT /host="Dianthus caryophyllus" FT /lab_host="Dianthus barbatus" FT /isolate="Solan" FT /mol_type="genomic RNA" FT /country="India:Northern Himalayan Region, Solan" FT /clone="390" FT /db_xref="taxon:11986" FT CDS 1..186 FT /gene="p7" FT /product="Movement protein p7" FT /db_xref="GOA:Q5ZF35" FT /db_xref="InterPro:IPR007982" FT /db_xref="UniProtKB/TrEMBL:Q5ZF35" FT /protein_id="CAH59640.1" FT /translation="MDIEPEVPVAGKQMLAGNRGKQKTRRSVAKDAIRKPASDSTNGGN FT WVNVADKSEVHIHFNF" XX SQ Sequence 186 BP; 60 A; 32 C; 51 G; 43 T; 0 other; atggatattg aaccggaagt accagtagct ggaaagcaaa tgctcgctgg gaatagagga 60 aaacaaaaga cacgtagatc ggtggccaag gatgccatcc gtaaacctgc atctgatagt 120 actaacgggg gtaattgggt taatgttgct gataagagtg aggtgcacat tcacttcaac 180 ttttag 186 //