ID AJ517474; SV 1; linear; mRNA; STD; VRL; 936 BP. XX AC AJ517474; XX DT 11-SEP-2003 (Rel. 77, Created) DT 19-SEP-2003 (Rel. 77, Last updated, Version 2) XX DE Barley yellow mosaic virus partial gene for polyprotein, genomic RNA1, DE isolate WST, strain 1 XX KW 14 kDa protein; NIa protein; polyprotein; VPg protein. XX OS Barley yellow mosaic virus OC Viruses; Riboviria; Potyviridae; Bymovirus. XX RN [1] RP 1-936 RA Kanyuka K.; RT ; RL Submitted (19-NOV-2002) to the INSDC. RL Kanyuka K., Plant-Pathogen Interactions Division, Rothamsted Research, RL Harpenden, Hertfordshire, AL5 2JQ, UNITED KINGDOM. XX RN [2] RX DOI; 10.1099/vir.0.19347-0. RX PUBMED; 13679620. RA Kuehne T., Shi N., Proeseler G., Adams M., Kanyuka K.; RT "The ability of a bymovirus to overcome the rym4-mediated resistance in RT barley correlates with a codon change in the VPg coding region on RNA1."; RL J. Gen. Virol. 84(Pt 10):2853-2859(2003). XX DR MD5; b95c2b0f26d1a2ca00615dd46b0a1f83. XX FH Key Location/Qualifiers FH FT source 1..936 FT /organism="Barley yellow mosaic virus" FT /host="Hordeum vulgare" FT /strain="1" FT /isolate="WST" FT /mol_type="mRNA" FT /country="Germany" FT /db_xref="taxon:12465" FT CDS <1..>936 FT /codon_start=1 FT /product="polyprotein" FT /note="RNA1" FT /db_xref="GOA:Q70WG8" FT /db_xref="InterPro:IPR001730" FT /db_xref="UniProtKB/TrEMBL:Q70WG8" FT /protein_id="CAD57008.1" FT /translation="AVESKLCGFTFVFPDDDKIGLEGKGNKYRPREDARLMYSTREDAT FT FDAWDEKAKERRKKVTDKAEPELRRAYEKRPYFNFYDLQTDSNILEAIFYTTEGDEFFR FT TADPNKDMNLVADKLRSFLDTKLVVGHHQRKLLEETAEVVIKDTKGTAHKMAISQHDPD FT SLKQNGSGKVGYPEHRGQFRQEGVAITGDYDLEAEFGADTDEITLEASTGILLSQVGVD FT VATRVGRICIGTFNMNCYFYSDWILVPGHLQDRSGNVTIQFPDQTVQTTTDALNANGVK FT RFYGLDVIAIRRPAALRPRTKLVKAFAIEEP" FT mat_peptide <1..66 FT /product="14 kDa protein" FT mat_peptide 67..627 FT /product="VPg protein" FT mat_peptide 628..>936 FT /product="NIa protein" XX SQ Sequence 936 BP; 273 A; 205 C; 231 G; 227 T; 0 other; gctgttgaga gcaaactatg tggtttcacc tttgtttttc cagatgatga taaaattggt 60 cttgaaggca aggggaacaa ataccgccct cgcgaagacg ctcgcctgat gtactccact 120 agagaggacg ccacctttga cgcctgggat gagaaagcga aggaaagacg taagaaggta 180 accgacaaag ctgagccaga gcttcggaga gcctatgaga agagaccata cttcaatttc 240 tacgatcttc aaacagatag caacattctg gaagctattt tctacaccac tgaaggcgat 300 gagtttttcc gaacagcaga ccctaataag gacatgaact tggttgctga taaactacgc 360 tcctttctcg atacaaagct tgttgttgga caccatcagc ggaagctact agaagaaaca 420 gctgaggttg ttattaagga tacgaaggga actgcgcaca agatggctat ttcacagcat 480 gatccagatt ctctgaagca gaatgggtcc ggcaaagttg ggtatccaga acaccgagga 540 cagtttcggc aggaaggagt tgccatcaca ggggattacg atcttgaagc tgagtttggc 600 gccgacaccg atgaaataac gcttgaggcc tctactggaa ttttattgtc acaagttggg 660 gtcgatgttg caactcgagt tgggagaatt tgcattggca ctttcaatat gaactgttac 720 ttctatagcg actggattct agttccagga cacctgcaag atagatctgg caacgtaaca 780 attcaattcc ctgaccaaac agtgcaaacc acaaccgatg cactcaacgc gaatggtgtg 840 aaacgattct atggattaga tgtgatagca attcgtcgcc ctgctgcctt gcggcctcgc 900 accaagttgg tcaaagcttt tgctattgag gaacca 936 //