ID AJ512771; SV 1; linear; genomic DNA; STD; VRL; 502 BP. XX AC AJ512771; XX DT 25-OCT-2002 (Rel. 73, Created) DT 10-NOV-2003 (Rel. 77, Last updated, Version 2) XX DE tobacco curly shoot virus AV2 gene and partial AV1 gene for coat protein, DE isolate Y132 XX KW AV1 gene; AV2 gene; AV2 protein; coat protein. XX OS Tobacco curly shoot virus OC Viruses; Geminiviridae; Begomovirus. XX RN [1] RP 1-502 RA Zhou X.; RT ; RL Submitted (23-OCT-2002) to the INSDC. RL Zhou X., Zhejiang University, Institute of Biotechnology, Kaixuan Road RL 268,HangZhou, Zhejiang,310029, CHINA. XX RN [2] RA Li G., Fan S., Li Z., Xie Y., Zhou X.; RT "Genomic characterization of DNA-A and associated satellite DNA mole cule RT of an isolate of Tomato Yellow leaf curl China virus infecting Nicotiana ta RT bacum White Burley in Yunnan"; RL Nong Ye Sheng Wu Ji Shu Xue Bao 11(5):525-530(2003). XX DR MD5; 6045d963818b83f84ca55f1172a88249. XX FH Key Location/Qualifiers FH FT source 1..502 FT /organism="Tobacco curly shoot virus" FT /isolate="Y132" FT /mol_type="genomic DNA" FT /country="China:Yunnan" FT /db_xref="taxon:180526" FT CDS 119..475 FT /transl_table=1 FT /gene="AV2" FT /product="AV2 protein" FT /db_xref="GOA:Q8AYT9" FT /db_xref="InterPro:IPR002511" FT /db_xref="InterPro:IPR005159" FT /db_xref="UniProtKB/TrEMBL:Q8AYT9" FT /protein_id="CAD54851.1" FT /translation="MWDPLVNEFPETVHGFRCMLAVKYLQLVEKTYSPDTLGHDLIRDL FT ISVIRARNYVEATSRYNHFHARFEGTPPSQLRQPICEPCCCPHCPRHQSKSMGEQAHEQ FT KAQDVQDVQKSRCP" FT CDS 279..>502 FT /transl_table=1 FT /gene="AV1" FT /product="coat protein" FT /db_xref="GOA:Q8B6W1" FT /db_xref="UniProtKB/TrEMBL:Q8B6W1" FT /protein_id="CAD54852.1" FT /translation="MSKRPADIIISTPASKVRRRLNFDSPYVSRAAAPIVRVTKARAWA FT NRPMNRKPRMYRMFRSPDVPRGCEGPCKV" XX SQ Sequence 502 BP; 135 A; 117 C; 115 G; 135 T; 0 other; taatattacc tgttggcccc ttgatgtgat atgtcatcca atcagaacgc tctcccaaag 60 cttaattgtt ttgtggtccc ctatttatac ttgctcagca agtagtgcat tccgcactat 120 gtgggatcca ttagtgaacg agtttcccga aactgttcac ggttttagat gtatgttagc 180 agttaaatat ctgcagttag tagagaagac ttattcgcct gacacattag ggcacgattt 240 aattagggat ttaatttcag ttattagggc tagaaattat gtcgaagcga ccagcagata 300 taatcatttc cacgcccgct tcgaaggtac gccgccgtct caacttcgac agcccatatg 360 tgagccgtgc tgctgccccc attgtccgcg tcaccaaagc aagagcatgg gcgaacaggc 420 ccatgaacag aaagcccagg atgtacagga tgttcagaag tccagatgtc cctagaggat 480 gtgaagggcc atgcaaagtc ca 502 //