ID AJ130707; SV 1; linear; genomic RNA; STD; VRL; 666 BP. XX AC AJ130707; XX DT 11-NOV-1999 (Rel. 61, Created) DT 14-FEB-2001 (Rel. 66, Last updated, Version 2) XX DE Alfalfa mosaic virus gene encoding coat protein, isolate Caa 1 XX KW coat protein. XX OS Alfalfa mosaic virus OC Viruses; Riboviria; Bromoviridae; Alfamovirus. XX RN [1] RP 1-666 RA Parrella G.; RT ; RL Submitted (10-NOV-1998) to the INSDC. RL Parrella G., Dipartimento Protezione delle piante dalle Malattie, CNR RL Centro Studi Virus e Virosi delle Colture Mediterranee, Via Amendola, RL 165/A, Bari 70126, ITALY. XX RN [3] RX DOI; 10.1007/s007050070014. RX PUBMED; 11205111. RA Parrella G., Lanave C., Marchoux G., Finetti Sialer M.M., Di Franco A., RA Gallitelli D.; RT "Evidence for two distinct subgroups of alfalfa mosaic virus (AMV) from RT france and italy and their relationships with other AMV strains Brief RT report"; RL Arch. Virol. 145(12):2659-2667(2000). XX DR MD5; fdac338a8141f44be873b709b178b06f. XX FH Key Location/Qualifiers FH FT source 1..666 FT /organism="Alfalfa mosaic virus" FT /lab_host="Nicotiana glutinosa" FT /strain="Caa 1" FT /mol_type="genomic RNA" FT /db_xref="taxon:12321" FT CDS 1..666 FT /product="coat protein" FT /db_xref="GOA:Q9QCM8" FT /db_xref="UniProtKB/TrEMBL:Q9QCM8" FT /protein_id="CAB60714.1" FT /translation="MSSSQKKAGGKAGKPTKRSQNYAALRKAQLPKPPALKVPVAKPTN FT TILPQTGCVWQSLGTPLSLSSSNGLGARFLYSFLKDFVAPRILEEDLIFRMVFSITPSH FT AGSFCLTDDVTTEDGRAVAHGNPMQEFPHGIFHANEKFGFELVFTAPTHAGMQNQNFKH FT SYAVALCLDFDALPEGSKNPSYRFNEVWVERKAFPRAGPLRSLITVGLFNDADDLDRQ" XX SQ Sequence 666 BP; 157 A; 166 C; 168 G; 175 T; 0 other; atgagttctt cacaaaagaa agctggtggg aaagctggta aacctactaa acgttctcag 60 aactatgctg ctctacgcaa agctcaactg ccgaagcctc cggcgttgaa agtcccggtt 120 gcgaaaccga cgaatactat actgccacag acgggctgcg tgtggcaaag cctcgggacc 180 cctctgagtc tgagctcttc aaatgggctc ggtgcgagat tcctctacag ttttctgaag 240 gatttcgtag cacctcgaat cctcgaagag gatttgattt tcaggatggt gttttctata 300 acaccgtccc atgccggctc cttttgtctc actgatgacg tgacgactga ggatggtagg 360 gccgttgcgc atggtaatcc catgcaggaa tttcctcatg gcatttttca cgccaatgag 420 aagttcgggt ttgagttggt cttcacagct cctacccatg cgggaatgca aaatcaaaat 480 ttcaagcatt cctatgccgt agccctttgt ttggacttcg acgctctgcc tgagggatct 540 aaaaatccct cataccgatt caacgaagtt tgggtcgaga gaaaggcgtt tccgcgagca 600 gggcccctcc gcagtttgat tactgtgggg ctgttcaacg atgctgacga tcttgatcgt 660 caatga 666 //