ID AJ130705; SV 1; linear; genomic RNA; STD; VRL; 657 BP. XX AC AJ130705; XX DT 11-NOV-1999 (Rel. 61, Created) DT 14-FEB-2001 (Rel. 66, Last updated, Version 2) XX DE Alfalfa mosaic virus gene encoding coat protein, isolate 195 AN XX KW coat protein. XX OS Alfalfa mosaic virus OC Viruses; Riboviria; Bromoviridae; Alfamovirus. XX RN [1] RP 1-657 RA Parrella G.; RT ; RL Submitted (10-NOV-1998) to the INSDC. RL Parrella G., Dipartimento Protezione delle piante dalle Malattie, CNR RL Centro Studi Virus e Virosi delle Colture Mediterranee, Via Amendola, RL 165/A, Bari 70126, ITALY. XX RN [3] RX DOI; 10.1007/s007050070014. RX PUBMED; 11205111. RA Parrella G., Lanave C., Marchoux G., Finetti Sialer M.M., Di Franco A., RA Gallitelli D.; RT "Evidence for two distinct subgroups of alfalfa mosaic virus (AMV) from RT france and italy and their relationships with other AMV strains Brief RT report"; RL Arch. Virol. 145(12):2659-2667(2000). XX DR MD5; 71d89971eaa78a0f609268aba4ce7ac0. XX FH Key Location/Qualifiers FH FT source 1..657 FT /organism="Alfalfa mosaic virus" FT /lab_host="Nicotiana glutinosa" FT /strain="195 AN" FT /mol_type="genomic RNA" FT /db_xref="taxon:12321" FT CDS 1..657 FT /product="coat protein" FT /db_xref="GOA:Q9QCN0" FT /db_xref="InterPro:IPR002681" FT /db_xref="UniProtKB/TrEMBL:Q9QCN0" FT /protein_id="CAB60712.1" FT /translation="MSSSQKKAGGKAGKPTKRSQNYAALRKAQLPKPPALKVPVAKPTN FT TILPQTGCVWQSLGTPLSLSSFNGLGVRFLYSFLKDFAGPRILEEDLIYRMVFSITPSH FT AGSFCLTDDVTTEDGRAVAHGNPMQEFPQGVFHANEKFGFELVFTAPTHAGMQNQNFND FT SYAVALCLDFDAQPEGSKNPSYRFNEVWVERKAFPRAGPLRSLITVGLVAEADDL" XX SQ Sequence 657 BP; 155 A; 164 C; 171 G; 167 T; 0 other; atgagttctt cacaaaagaa agctggtggg aaagctggta aacctactaa acgttctcag 60 aactatgctg ctctacgcaa agctcaactg ccgaagcctc cggcgttgaa agtcccggtt 120 gcaaaaccga cgaatactat actgccacag acgggctgtg tgtggcaaag cctcgggacc 180 cctctgagtc tgagctcttt taatgggctc ggcgtgagat tcctctacag ttttctgaag 240 gatttcgcgg gacctcggat cctcgaagag gatctgattt acaggatggt gttttctata 300 acaccgtccc atgccggctc tttttgtctc actgatgacg tgacgactga ggatggtagg 360 gccgttgcgc atggtaatcc catgcaagaa tttcctcaag gcgtgtttca cgccaatgag 420 aagttcgggt ttgagttggt cttcacagct cctacccatg cgggaatgca aaatcaaaat 480 ttcaacgatt cctatgccgt agccctctgt ttggacttcg atgcgcagcc tgagggatct 540 aaaaatccct cataccgatt caacgaagtt tgggtcgaga gaaaggcgtt cccgcgagca 600 gggcccctcc gcagtttgat tactgtgggg ctcgtcgcag aagctgacga tctttga 657 //