ID AF215664; SV 1; linear; genomic RNA; STD; VRL; 746 BP. XX AC AF215664; XX DT 29-DEC-1999 (Rel. 62, Created) DT 28-AUG-2003 (Rel. 77, Last updated, Version 2) XX DE Alfalfa mosaic virus strain NZ34 coat protein gene, complete cds. XX KW . XX OS Alfalfa mosaic virus OC Viruses; Riboviria; Bromoviridae; Alfamovirus. XX RN [1] RP 1-746 RA Timmerman-Vaughan G.M., Pither-Joyce M.D., Cooper P.A., Russell A.C., RA Goulden D.S., Butler R.C., Grant J.E.; RT "Partial Resistance of Transgenic Peas to Alfalfa Mosaic Virus under RT Greenhouse and Field Conditions"; RL Crop Sci. 41(3):846-853(2001). XX RN [2] RP 1-746 RA Pither-Joyce M.D.; RT ; RL Submitted (12-DEC-1999) to the INSDC. RL New Zealand Institute for Crop & Food Research Ltd, Private Bag 4704, RL Christchurch, New Zealand XX DR MD5; 982fb99be498ce3f7baa5df9a5a60560. DR RFAM; RF00252; Alfamo_CPB. XX FH Key Location/Qualifiers FH FT source 1..746 FT /organism="Alfalfa mosaic virus" FT /strain="NZ34" FT /mol_type="genomic RNA" FT /db_xref="taxon:12321" FT primer_bind 1..20 FT CDS 7..672 FT /codon_start=1 FT /product="coat protein" FT /db_xref="GOA:Q9Q2U0" FT /db_xref="InterPro:IPR002681" FT /db_xref="UniProtKB/TrEMBL:Q9Q2U0" FT /protein_id="AAF20159.1" FT /translation="MSSSQKKAGGKAGKPTKRSQNYAALRKAQLPKPPALKVPVAKPTN FT IILPQTGCVWQSLGTPLSLSSFNGLGVRFLYSFLKDFAGPRILEEDLIYRMVFSITPSH FT AGTFCLTDDVTTEDGRAVAHGNPMQEFPHGAFHANEKFGFELVFTAPTHAGMQNQNFKH FT SYAVALCLDFDAQPEGSKNPSYRFNEVWVERKAFPRAGPLRSLITVGLFDEADDLDRH" XX SQ Sequence 746 BP; 179 A; 179 C; 190 G; 198 T; 0 other; tccatcatga gttcttcaca aaagaaagct ggtgggaaag ctggtaaacc tactaaacgt 60 tctcagaact atgctgcttt acgcaaagct caactgccga agcctccggc gttgaaagtc 120 ccggttgcaa aaccgacgaa tattatactg ccacagacgg gctgcgtgtg gcaaagcctc 180 gggacccctc tgagtctgag ctcttttaat gggctcggcg tgagattcct ctacagtttt 240 ctgaaggatt tcgcgggacc tcggatcctc gaagaggatc tgatttacag gatggtgttt 300 tctataacac cgtcccatgc cggcactttt tgtctcactg atgacgtgac gactgaggat 360 ggtagggccg ttgcgcatgg taatcccatg caagaatttc ctcatggcgc atttcacgct 420 aatgagaagt tcgggtttga gttggtcttc acagctccta cccatgcggg aatgcaaaat 480 caaaatttta agcattccta tgccgtagcc ctctgtttgg acttcgatgc gcagcctgag 540 ggatctaaaa atccctcata ccgattcaac gaagtttggg tcgagagaaa ggcgttcccg 600 cgagcagggc ccctccgcag tttgattact gtggggctgt tcgacgaagc tgacgatctt 660 gatcgtcatt gatgtacccc attaatttgg gatgctaaag tcatttaatg ctgacctcca 720 ctgggtggat taaggtcaag gtatga 746 //